[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55374.1
DDBJ      :             transporter, major facilitator family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:415 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->412 1pv7A_ f.38.1.2 * 5.2e-13 19.6 %
:HMM:PFM   14->377 PF07690 * MFS_1 2e-11 19.8 334/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55374.1 GT:GENE ACF55374.1 GT:PRODUCT transporter, major facilitator family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1947755..1949002) GB:FROM 1947755 GB:TO 1949002 GB:DIRECTION - GB:PRODUCT transporter, major facilitator family GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF55374.1 GB:DB_XREF GI:194356926 LENGTH 415 SQ:AASEQ MKLLFRNPAYRILTLSRFFNAFGASIFNLVFIVYASTLSQASFAVAMANIVMILPTLFTVFVGIRADYTRDKVKWMVYSGLFQAVLFFLAALVVQQASLFAFSSLCLINVISDIISDFAGGLRMPLIKEKVAEDDLMEAYSFSQFITYISAIGGQAFGVWLLALSVNNFSLVAGINACFFLVSATILFLGKSKLSLSMSSADGENLKNDKLSIKDQFLTIYRNLRLVFLKSGQKNFGFMLFAVLLINSLGGALGGIYNIFFLSHSLLNFSYTEALFINQFCVLVAIIISSLTGNDYFGKQSLPRLMMWATVGLSLVGLANLFNQVVLGLLFLFFTLYVSGKVQPKISAMLMKNLAPEVLAHTSNFLGLLFTLSIPVGTACFSLVAVWNIQLTWMLFVGLSLLAIFLTILNLKNDI GT:EXON 1|1-415:0| TM:NTM 11 TM:REGION 17->39| TM:REGION 44->65| TM:REGION 74->96| TM:REGION 102->124| TM:REGION 144->166| TM:REGION 169->190| TM:REGION 236->258| TM:REGION 274->296| TM:REGION 310->332| TM:REGION 363->385| TM:REGION 392->414| SEG 81->97|lfqavlfflaalvvqqa| SEG 191->200|ksklslsmss| SEG 321->338|lfnqvvlgllflfftlyv| HM:PFM:NREP 1 HM:PFM:REP 14->377|PF07690|2e-11|19.8|334/353|MFS_1| HM:SCP:REP 1->412|1pv7A_|5.2e-13|19.6|392/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 67 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--23--11----1--11---222111132263333323-------------111222111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 200-211,414-416| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //