[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55375.1
DDBJ      :             hypothetical protein, degenerate
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55375.1 GT:GENE ACF55375.1 GT:PRODUCT hypothetical protein, degenerate GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(804157..804303) GB:FROM 804157 GB:TO 804303 GB:DIRECTION - GB:PRODUCT hypothetical protein, degenerate GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55375.1 GB:DB_XREF GI:194356927 LENGTH 48 SQ:AASEQ MIDALFSPVQKDSPSDIQSIYDQRAPSRQGKVLTYAERQLYDQKNEVS GT:EXON 1|1-48:0| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 42-49| PSIPRED ccHHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHccc //