[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55382.1
DDBJ      :             IS66-Spn1, transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->100 PF05717 * Transposase_34 1e-25 52.7 %
:HMM:PFM   10->104 PF05717 * Transposase_34 6e-40 48.4 95/108  
:BLT:SWISS 10->100 Y4HO_RHISN 4e-14 38.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55382.1 GT:GENE ACF55382.1 GT:PRODUCT IS66-Spn1, transposase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(719810..720133) GB:FROM 719810 GB:TO 720133 GB:DIRECTION - GB:PRODUCT IS66-Spn1, transposase GB:NOTE identified by match to protein family HMM PF05717 GB:PROTEIN_ID ACF55382.1 GB:DB_XREF GI:194356934 LENGTH 107 SQ:AASEQ MMILLSDLGQVHLVCGKTDMRQGIDSLAYVVKTHFELDPFSGQVFLFCGGRKYRFKALYWDGQGFWLLYKRFENGRLTWPSTEKDVKALTSEQVDWLMKGFSITPQI GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 10->100|Y4HO_RHISN|4e-14|38.5|91/115| RP:PFM:NREP 1 RP:PFM:REP 10->100|PF05717|1e-25|52.7|91/105|Transposase_34| HM:PFM:NREP 1 HM:PFM:REP 10->104|PF05717|6e-40|48.4|95/108|Transposase_34| OP:NHOMO 807 OP:NHOMOORG 163 OP:PATTERN -------------------------------------------------------------------- --3----------------------------------------------------------------------------------------3---------------------------------------------------------------------------------------------------2-----------------------------------------------------------------44---2---551--------------------131331512431----1--------11---111--2-------------4---------1----2-21-1-23---1----------2----------7253---1--51-111111118---1--3---1--3--97-344-3416-----31F24---656666661----4----------------------------------21-----3--24--7----1123121--A1B9-321----------222-1---1----------------A1--B5--2---C--------------2-131----------------------------34----1----1--111-------31----------2----------------EG7-222H1-E--1125--6F34--------1---5--1---------------Ae47163----------------------------------------------------------9-------1-63---e------------*--E-----x--------------------2-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccccccccEEEEEcccEEccccHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEEcccEEEEEEHHHccccccccccccEEEEcHHHHHHHHccccccccc //