[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55383.1
DDBJ      :             translation initiation factor IF-3
Swiss-Prot:IF3_STRZT    RecName: Full=Translation initiation factor IF-3;

Homologs  Archaea  0/68 : Bacteria  887/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
d.15.8d.68.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->76 1tifA PDBj 1e-15 57.4 %
:BLT:PDB   96->183 1tigA PDBj 6e-31 68.2 %
:RPS:PDB   94->185 2crqA PDBj 8e-19 22.8 %
:RPS:SCOP  16->76 1tifA  d.15.8.1 * 8e-20 57.4 %
:RPS:SCOP  96->180 1tigA  d.68.1.1 * 6e-30 69.4 %
:HMM:SCOP  16->91 1tifA_ d.15.8.1 * 2.5e-27 57.9 %
:HMM:SCOP  95->184 2ifeA_ d.68.1.1 * 4.7e-33 53.3 %
:RPS:PFM   20->76 PF05198 * IF3_N 1e-12 61.4 %
:RPS:PFM   95->180 PF00707 * IF3_C 7e-22 59.3 %
:HMM:PFM   96->181 PF00707 * IF3_C 2.3e-38 55.8 86/88  
:HMM:PFM   18->90 PF05198 * IF3_N 3.1e-31 57.5 73/76  
:BLT:SWISS 1->185 IF3_STRZT 3e-88 99.5 %
:PROS 71->84|PS00938|IF3
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55383.1 GT:GENE ACF55383.1 GT:PRODUCT translation initiation factor IF-3 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 853469..854026 GB:FROM 853469 GB:TO 854026 GB:DIRECTION + GB:PRODUCT translation initiation factor IF-3 GB:NOTE identified by match to protein family HMM PF00707; match to protein family HMM PF05198; match to protein family HMM TIGR00168 GB:PROTEIN_ID ACF55383.1 GB:DB_XREF GI:194356935 LENGTH 185 SQ:AASEQ MFFSNKTKEVKTIAKQDLFIXDEIRVREVRLIGLEGEQLGIKPLSEAQALADNANVDLVLIQPQAKPPVAKIMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPTIDKGDFDTKLRNARKFLEKGNKVKVSIRFKGRMITHKEIGAKVLAEFAEATQDIAIIEQRAKMDGRQMFMQLAPATDKK GT:EXON 1|1-185:0| SW:ID IF3_STRZT SW:DE RecName: Full=Translation initiation factor IF-3; SW:GN Name=infC; OrderedLocusNames=SPT_1244; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|IF3_STRZT|3e-88|99.5|185/185| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 71->84|PS00938|IF3|PDOC00723| SEG 77->93|kfkfeyqkkqkeqrkkq| BL:PDB:NREP 2 BL:PDB:REP 16->76|1tifA|1e-15|57.4|61/76| BL:PDB:REP 96->183|1tigA|6e-31|68.2|88/88| RP:PDB:NREP 1 RP:PDB:REP 94->185|2crqA|8e-19|22.8|92/112| RP:PFM:NREP 2 RP:PFM:REP 20->76|PF05198|1e-12|61.4|57/74|IF3_N| RP:PFM:REP 95->180|PF00707|7e-22|59.3|86/87|IF3_C| HM:PFM:NREP 2 HM:PFM:REP 96->181|PF00707|2.3e-38|55.8|86/88|IF3_C| HM:PFM:REP 18->90|PF05198|3.1e-31|57.5|73/76|IF3_N| GO:PFM:NREP 4 GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF05198|IPR019814| GO:PFM GO:0006413|"GO:translational initiation"|PF05198|IPR019814| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF00707|IPR019815| GO:PFM GO:0006413|"GO:translational initiation"|PF00707|IPR019815| RP:SCP:NREP 2 RP:SCP:REP 16->76|1tifA|8e-20|57.4|61/76|d.15.8.1| RP:SCP:REP 96->180|1tigA|6e-30|69.4|85/88|d.68.1.1| HM:SCP:REP 16->91|1tifA_|2.5e-27|57.9|76/76|d.15.8.1|1/1|Translation initiation factor IF3, N-terminal domain| HM:SCP:REP 95->184|2ifeA_|4.7e-33|53.3|90/0|d.68.1.1|1/1|Translation initiation factor IF3, C-terminal domain| OP:NHOMO 929 OP:NHOMOORG 907 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111112221111111111111111111111111111111111111111111-111111111111111112211111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111111-111111111111111111111112211111111111111111111111111111111111111111-111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111--1111111111111111111-11-11-111----1--11111-11111111111111111111111111111111-11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-----------------------------------------------------------------------------------------------------1------1------------------------------------------------------2--1-21117111112--2-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 84.9 SQ:SECSTR ###############cccccGGGccccEEEEEcTTccEEEEEEHHHHHHHHHHTTcEEEEEETTccccEEEEEcHH#############ccHHccccEEEEEEETTccHHHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHTTcTTTcEEEEEEEEGGTEEEEEEEcccccc DISOP:02AL 1-1,3-22,80-98,183-186| PSIPRED cccccHHHccccccccccccHHcccccEEEEEcccccEEccccHHHHHHHHHHccccEEEEcccccccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHEEccccccccEEEEEEEEccccc //