[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55384.1
DDBJ      :             aminopeptidase PepS
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  239/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.60.1
:413 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->413 1zjcA PDBj e-106 48.6 %
:RPS:PDB   6->412 2ayiA PDBj e-126 42.0 %
:RPS:SCOP  6->412 2ayiA1  e.60.1.1 * e-126 42.0 %
:HMM:SCOP  5->413 2ayiA1 e.60.1.1 * 6.6e-140 46.3 %
:RPS:PFM   10->411 PF02073 * Peptidase_M29 2e-85 46.9 %
:HMM:PFM   6->411 PF02073 * Peptidase_M29 2.4e-154 50.4 395/398  
:BLT:SWISS 1->411 PEPS_STRTR 0.0 83.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55384.1 GT:GENE ACF55384.1 GT:PRODUCT aminopeptidase PepS GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 253433..254674 GB:FROM 253433 GB:TO 254674 GB:DIRECTION + GB:PRODUCT aminopeptidase PepS GB:NOTE identified by match to protein family HMM PF02073 GB:PROTEIN_ID ACF55384.1 GB:DB_XREF GI:194356936 LENGTH 413 SQ:AASEQ MVLPNFKENLGKYAKLLVANGINVQPGHTLALSIDVEQRELAHLIVKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVRSSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAASDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDLTLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIEGIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTLFDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIREDGTRVPLFRNGNWAN GT:EXON 1|1-413:0| BL:SWS:NREP 1 BL:SWS:REP 1->411|PEPS_STRTR|0.0|83.0|411/413| BL:PDB:NREP 1 BL:PDB:REP 5->413|1zjcA|e-106|48.6|407/413| RP:PDB:NREP 1 RP:PDB:REP 6->412|2ayiA|e-126|42.0|395/397| RP:PFM:NREP 1 RP:PFM:REP 10->411|PF02073|2e-85|46.9|377/382|Peptidase_M29| HM:PFM:NREP 1 HM:PFM:REP 6->411|PF02073|2.4e-154|50.4|395/398|Peptidase_M29| GO:PFM:NREP 2 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF02073|IPR000787| GO:PFM GO:0006508|"GO:proteolysis"|PF02073|IPR000787| RP:SCP:NREP 1 RP:SCP:REP 6->412|2ayiA1|e-126|42.0|395/397|e.60.1.1| HM:SCP:REP 5->413|2ayiA1|6.6e-140|46.3|406/0|e.60.1.1|1/1|Thermophilic metalloprotease-like| OP:NHOMO 324 OP:NHOMOORG 253 OP:PATTERN 111-11------------------23322222------------------------------------ 11----------------------------------------------------------------------------1---1-------------------------1------------------------------1111121-------------------------------------33322--112122222322233233312111123211121222222226321111111111111111111----11---------1111111----11111-11--11111111111-------------1111111111121-2111111111111--1222-1-11-----2211--1-1----1--1-------11111--11111--1---1111111-111-1111111-11-11111111111111--------------111111111111---------------------------------------------------------------------------------------------------------------1-1-111-12111-11111-1-1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111111111-1-------------------------1--11-1----11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 409 STR:RPRED 99.0 SQ:SECSTR ####ccHHHHHHHHHHHHHTTTcccTTcEEEEEEcTTcHHHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHHccTTcTTcccHHHHHHHHHHHHTTcEEEEEEcccGGGcTTccHHHHHHHHHHHHHHHHHHHHHHHTTccccccEEcccTTTHHHHccccccHHHHHHHHHHHHHHHHTTGGHccHHHHHHHHHHHHHHHHHHHHTTccEEEEEETTEEEEEEccTTcccEEcccccccccccccccccccEEEcccTTcEEEEEEccccEEETTEEEcccEEEEETTEEEEEEccccHHHHHHHTTcccGGGcEEEEEcccTTcHHHHHTcccccHHHHHTTccEEEEEcccGGGccccGGccHccHHHHTccccccEEEEEcccTTcEEEEEcTTccEEEEEETTEEcT DISOP:02AL 1-3,413-414| PSIPRED cccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHcccEEEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEEcccEEEEccccccccccccccccccccEEEccccccEEEEEEEEEEEccccEEEccEEEEEEccEEEEEEcccHHHHHHHHHccccccEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEcccccccccccccccHHHHHHcccccccEEEEEEEcccEEEEEEEEccccEEEEEEcccccc //