[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55387.1
DDBJ      :             Phosphoglucomutase/phosphomannomutase family protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  544/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
c.121.1c.84.1d.129.2
:572 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   40->420 1tuoA PDBj 6e-16 27.3 %
:RPS:PDB   27->559 1c47A PDBj 6e-83 20.1 %
:RPS:SCOP  27->216 1c47A1  c.84.1.1 * 5e-35 21.4 %
:RPS:SCOP  218->392 1nn4A  c.121.1.1 * 3e-25 10.5 %
:RPS:SCOP  516->558 1k2yX4  d.129.2.1 * 5e-06 27.5 %
:HMM:SCOP  24->236 1kfiA1 c.84.1.1 * 2.3e-52 32.8 %
:HMM:SCOP  205->321 1k2yX2 c.84.1.1 * 9e-19 32.7 %
:HMM:SCOP  304->455 1kfiA3 c.84.1.1 * 2.3e-34 39.2 %
:HMM:SCOP  442->572 1wjwA_ d.129.2.1 * 1.7e-17 30.5 %
:RPS:PFM   40->178 PF02878 * PGM_PMM_I 3e-23 45.1 %
:RPS:PFM   208->311 PF02879 * PGM_PMM_II 4e-11 40.2 %
:RPS:PFM   325->420 PF02880 * PGM_PMM_III 1e-13 46.5 %
:RPS:PFM   501->558 PF00408 * PGM_PMM_IV 3e-07 41.4 %
:HMM:PFM   40->180 PF02878 * PGM_PMM_I 5.1e-44 40.7 135/138  
:HMM:PFM   227->311 PF02879 * PGM_PMM_II 3.6e-25 44.4 81/105  
:HMM:PFM   325->451 PF02880 * PGM_PMM_III 2.9e-23 32.7 110/111  
:HMM:PFM   501->547 PF00408 * PGM_PMM_IV 2.8e-14 42.4 33/73  
:BLT:SWISS 1->559 PGCA_BACSU e-144 46.0 %
:PROS 138->147|PS00710|PGM_PMM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55387.1 GT:GENE ACF55387.1 GT:PRODUCT Phosphoglucomutase/phosphomannomutase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1373454..1375172 GB:FROM 1373454 GB:TO 1375172 GB:DIRECTION + GB:PRODUCT Phosphoglucomutase/phosphomannomutase family protein GB:NOTE identified by match to protein family HMM PF00408; match to protein family HMM PF02878; match to protein family HMM PF02879; match to protein family HMM PF02880 GB:PROTEIN_ID ACF55387.1 GB:DB_XREF GI:194356939 LENGTH 572 SQ:AASEQ MSYQENYQKWVDFVELPDYLRQDLENMDEKTKEDAFYTNLEFGTAGMRGLVGAGTNRINIYVVRQATEGLARLIESKGGNEKERGVAIAYDSRHFSPEFAFESAAVLAKHGIKSYVFESLRPTPELSFAVRHLNCFAGIMVTASHNPAPFNGYKVYGEDGGQMPPHDADALTTYIRAIENPFAVEVADVETEKASGLIEVIGEAVDVEYLKEVKDVNINPALIEEFGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQATADPDFSTVTSPNPESQAAFALAEELGRQVGADVLVATDPDADRVGVEVLQKDGSYLNLSGNQIGAIMAKYILEAHKNAGTLPENAALCKSIVSTDLVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMMGFEESFGYLIKPFVRDKDAIQAVLVVAELAAYYRSRGLTLADGIEEIYKEYGYYAEKTISVTLSGVDGAEQIKAIMAKFRNNAPKEWNATAITVVEDFKAQTATVADGTVTNLTTPPSDVLKYTLADGSWIAVRPSGTEPKIKFYIAVVGETNEESQAKIANIEAEINAFVK GT:EXON 1|1-572:0| BL:SWS:NREP 1 BL:SWS:REP 1->559|PGCA_BACSU|e-144|46.0|557/581| PROS 138->147|PS00710|PGM_PMM|PDOC00589| SEG 422->431|avlvvaelaa| SEG 443->457|gieeiykeygyyaek| SEG 560->569|ianieaeina| BL:PDB:NREP 1 BL:PDB:REP 40->420|1tuoA|6e-16|27.3|337/437| RP:PDB:NREP 1 RP:PDB:REP 27->559|1c47A|6e-83|20.1|507/561| RP:PFM:NREP 4 RP:PFM:REP 40->178|PF02878|3e-23|45.1|133/137|PGM_PMM_I| RP:PFM:REP 208->311|PF02879|4e-11|40.2|97/103|PGM_PMM_II| RP:PFM:REP 325->420|PF02880|1e-13|46.5|86/114|PGM_PMM_III| RP:PFM:REP 501->558|PF00408|3e-07|41.4|58/76|PGM_PMM_IV| HM:PFM:NREP 4 HM:PFM:REP 40->180|PF02878|5.1e-44|40.7|135/138|PGM_PMM_I| HM:PFM:REP 227->311|PF02879|3.6e-25|44.4|81/105|PGM_PMM_II| HM:PFM:REP 325->451|PF02880|2.9e-23|32.7|110/111|PGM_PMM_III| HM:PFM:REP 501->547|PF00408|2.8e-14|42.4|33/73|PGM_PMM_IV| GO:PFM:NREP 8 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02879|IPR005845| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02879|IPR005845| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02880|IPR005846| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02880|IPR005846| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00408|IPR005843| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF00408|IPR005843| RP:SCP:NREP 3 RP:SCP:REP 27->216|1c47A1|5e-35|21.4|182/190|c.84.1.1| RP:SCP:REP 218->392|1nn4A|3e-25|10.5|152/159|c.121.1.1| RP:SCP:REP 516->558|1k2yX4|5e-06|27.5|40/96|d.129.2.1| HM:SCP:REP 24->236|1kfiA1|2.3e-52|32.8|192/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 205->321|1k2yX2|9e-19|32.7|104/104|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 304->455|1kfiA3|2.3e-34|39.2|120/120|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 442->572|1wjwA_|1.7e-17|30.5|95/0|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 1086 OP:NHOMOORG 748 OP:PATTERN 11-12---11111111-1------11121111111--------11111--12-11213212---1-11 221-111322221111111-31112111111211112111-11111321222122221111113121211-12221111122-2111111111111---1111111111111111112111111111111111121-----1112-12111112211111111111122211-11121-2112121111231222222222222222231211212222321122233333212222222222222221111212111111222111111111121---3332332211111111111112222222222222122111222122114222222232312112111312111111111241-21111112-11112----1-1----------11-1111111111112--------------11---------1-----1-1111--1---------1111-1-------------------11-----------1--------------------------------------11-------------------1---------21----2--11-2-21--2-222222212----3111------------1---------121---1-111----11322212111111221111--1211-----------------------------------------------1----1-11-11-11-1111---------1----------------111111------111111111111111112----------------1------------1---------12232222222222-----------------111111111111111112----1-1-11111---2111--1112222212111111 11--211-31-111-1111122221211122111111111111211----------------11111111111112111111111111-1311222111112122311-122122322222221321222E2-22222222222222121222526222246121123-1612211111----2-----1--113111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 533 STR:RPRED 93.2 SQ:SECSTR ##########################cccEEEEccccTTccccTTcEEEEHHHHHHcTTHHHHHHHHHHHHTccHHHHTTTTTcEEEEEEcccTTHHHHHHHHHHHHHHHTccEEEEEEEccHHHHHHHHHHHTccEEEEEccTTccccTTEEEEEETTcccccHHHHHHHHHHHHHccEEEEcTTccccTTcccEEEEEEHcccHHHHHHHHccHHHHHHHHHcHcccccEEEEcTTcTHHHHHHHHTTTTcccGGGEEEcTccccTTTTTcccccccTTTTHHHHHHHcHTccccEEEEEccccccEEEEEEcEEGGGccccHHHHHHHHHHcGGGcHHHHHHccccEEEEEETTccTHHHHHHHTTTccEEEEcccTHHHHHHHHTccEcTTTcccEEEETTTEEEETHTcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHHHHHHHHHHHTcTTTTTcEEEETTEEEEEEEEEEccEEcTTTccEEccccEEEEETTccEEEEEEEEccEEEEEEEEEEEccTTGGGcc############# PSIPRED ccHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEEccccccHHcEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEccHHHHHHHHHHHHHHHccHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHccccEEEEEcccccEEEEEEEcccccEEEEcHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHccccEEEEEEEccccEEcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHHHHHHHccHHHcccEEEEEEEccccccccccccccccccccccEEEEEEcccEEEEEEccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHc //