[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55391.1
DDBJ      :             adhesion lipoprotein, putative
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  624/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->304 3cx3A PDBj e-137 98.8 %
:RPS:PDB   32->302 3cx3B PDBj 8e-55 91.7 %
:RPS:SCOP  32->305 1k0fA  c.92.2.2 * 6e-64 22.4 %
:HMM:SCOP  30->306 1toaA_ c.92.2.2 * 2.9e-76 41.4 %
:RPS:PFM   25->304 PF01297 * SBP_bac_9 3e-49 38.0 %
:HMM:PFM   10->305 PF01297 * SBP_bac_9 4.8e-84 36.8 296/303  
:BLT:SWISS 20->304 ADCA_BACSU 1e-51 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55391.1 GT:GENE ACF55391.1 GT:PRODUCT adhesion lipoprotein, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 891309..892226 GB:FROM 891309 GB:TO 892226 GB:DIRECTION + GB:PRODUCT adhesion lipoprotein, putative GB:NOTE identified by match to protein family HMM PF01297 GB:PROTEIN_ID ACF55391.1 GB:DB_XREF GI:194356943 LENGTH 305 SQ:AASEQ MKKQNLFLVLLSVFLLCLGACGQKESQTGKGMKIVTSFYPIYAMVKEVSGDLNDVRMIQSSSGIHSFEPSANDIAAIYDADVFVYHSHTLESWAGSLDPNLKKSKVKVLEASEGMTLERVPXLEDVEAGDGVDEKTLYDPHTWLDPEKAGEEAQIIADKLSEVDSEHKETYQKNAQAFIKKAQELTKKFQPKFEKATQKTFVTQHTAFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQEFVKTYKVKTIFTESNASSKVAETLVKSTGVGLKTLNPLEADPQNDKTYLENLEENMSVLAEELK GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 20->304|ADCA_BACSU|1e-51|40.0|285/319| TM:NTM 1 TM:REGION 5->22| SEG 6->18|lflvllsvfllcl| BL:PDB:NREP 1 BL:PDB:REP 28->304|3cx3A|e-137|98.8|259/259| RP:PDB:NREP 1 RP:PDB:REP 32->302|3cx3B|8e-55|91.7|252/255| RP:PFM:NREP 1 RP:PFM:REP 25->304|PF01297|3e-49|38.0|271/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 10->305|PF01297|4.8e-84|36.8|296/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 32->305|1k0fA|6e-64|22.4|263/277|c.92.2.2| HM:SCP:REP 30->306|1toaA_|2.9e-76|41.4|266/277|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 1068 OP:NHOMOORG 641 OP:PATTERN ------------------------1112-111--1-----------1111111-------------13 --1-124-111213-------1---1------2---2122-1-112212---2111--11221111112121----1121---2-1221111-1--1---------1---122222221-11112111111111-12222211131242333212222112121222322211111112111121-1111--2122222122221212123222213121122213333332322222222222222223343411122111122211112-1-3-312444544432233333333333333333333333343211133331112322222222221-111111211432-111332111-1111111122-11----22222111111---1-2211111111112-111112--211233322223222212---2111122212------------111311111111-----------------1-11------11111-------------1---------1---------------1-11---1----111111111--112--12111111-2111-2121111111---1-1111121111111-1-------21122--111--------1----1------1-11-1---21231------51231331112123311-1111312121132111111333332222222222222222222322222222-322222212222--2------------2211-1121222222222--1---11--1-22221233-22211222111111111232231111122211----------------1211------------22-1------------------------111--111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 92.8 SQ:SECSTR ######################cccGGcccccEEEEccHHHHHHHHHHHGGGcEEEEccccccTTTccccHHHHHHHHHccEEEEccTTTcGGGGTcccTTTTccccEEEccTTcccccccccccEETTTTccccccccccGGGcHHHHHHHHHHHHHHTTTccTTcTTEEHHHHHHHHHHHHHHHHHHHHHTTTccccEEEEcccccHHHHHHTTcEEEEcccccTTccccHHHHHHHHHHHHHHcccEEEEccccccccTTTHHHHcccEEEEcccccccccccccHHHHHHHHHHHHTcccc DISOP:02AL 1-1,22-30,226-226,228-229,262-262| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHccEEEEEcccHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHc //