[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55392.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->60 PF04466 * Terminase_3 0.00029 26.9 52/387  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55392.1 GT:GENE ACF55392.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 89778..89999 GB:FROM 89778 GB:TO 89999 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55392.1 GB:DB_XREF GI:194356944 LENGTH 73 SQ:AASEQ MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLFLADEKGSEHTEAEVIDNLKEVIAKLKANA GT:EXON 1|1-73:0| SEG 6->19|klkklakelskllk| HM:PFM:NREP 1 HM:PFM:REP 6->60|PF04466|0.00029|26.9|52/387|Terminase_3| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111--111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,72-74| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc //