[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55395.1
DDBJ      :             CAAX amino terminal protease family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   127->214 PF02517 * Abi 8e-05 36.8 %
:HMM:PFM   126->217 PF02517 * Abi 1.4e-22 37.0 92/99  
:BLT:SWISS 102->171 Y715_MYCCT 4e-05 34.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55395.1 GT:GENE ACF55395.1 GT:PRODUCT CAAX amino terminal protease family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 147547..148224 GB:FROM 147547 GB:TO 148224 GB:DIRECTION + GB:PRODUCT CAAX amino terminal protease family GB:NOTE identified by match to protein family HMM PF02517 GB:PROTEIN_ID ACF55395.1 GB:DB_XREF GI:194356947 LENGTH 225 SQ:AASEQ MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVFQVLLVLILGTIATIAFVKSEHWKECGRFQFRWFYLGVFLLSFFLLFVWANLTTYIFPRTQNGSTVVEVATNLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVKRYYLDVLVSAAIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLVFGY GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 102->171|Y715_MYCCT|4e-05|34.3|67/336| TM:NTM 6 TM:REGION 11->33| TM:REGION 42->64| TM:REGION 77->99| TM:REGION 113->135| TM:REGION 155->177| TM:REGION 193->215| SEG 77->90|fylgvfllsffllf| RP:PFM:NREP 1 RP:PFM:REP 127->214|PF02517|8e-05|36.8|87/97|Abi| HM:PFM:NREP 1 HM:PFM:REP 126->217|PF02517|1.4e-22|37.0|92/99|Abi| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02517|IPR003675| OP:NHOMO 52 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-22222-21-112--1-------1----------------------------------------11------------------------------33333222223-------------1-------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //