[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55406.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->55 PF01148 * CTP_transf_1 0.00034 13.3 45/259  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55406.1 GT:GENE ACF55406.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1928358..1928564) GB:FROM 1928358 GB:TO 1928564 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55406.1 GB:DB_XREF GI:194356958 LENGTH 68 SQ:AASEQ MLKKYFSKYKWTDLFWILFVILTCLYIGNHDLFTLNHQEFSFRGSFWGLVLTLYHLXFIDKFVISNRK GT:EXON 1|1-68:0| TM:NTM 2 TM:REGION 13->32| TM:REGION 42->64| HM:PFM:NREP 1 HM:PFM:REP 11->55|PF01148|0.00034|13.3|45/259|CTP_transf_1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,68-69| PSIPRED cHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEHHHEEHHHHHHHHHHHHHHHHHHHHHHHcccc //