[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55424.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.289.1a.60.4
:53 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->47 1cooA PDBj 3e-05 26.7 %
:RPS:SCOP  3->47 2q0zX1  a.289.1.1 * 4e-06 20.0 %
:HMM:SCOP  3->52 1szpA1 a.60.4.1 * 0.00065 32.0 %
:HMM:PFM   27->46 PF00633 * HHH 9.5e-07 45.0 20/30  
:HMM:PFM   8->25 PF10391 * DNA_pol_lambd_f 0.0007 38.9 18/52  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55424.1 GT:GENE ACF55424.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 495915..496076 GB:FROM 495915 GB:TO 496076 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55424.1 GB:DB_XREF GI:194356976 LENGTH 53 SQ:AASEQ MGGLPLDRAKTFYDEGIKSASDFKNWTEKELLALKGIGPATIKKLKENGIKFK GT:EXON 1|1-53:0| RP:PDB:NREP 1 RP:PDB:REP 3->47|1cooA|3e-05|26.7|45/81| HM:PFM:NREP 2 HM:PFM:REP 27->46|PF00633|9.5e-07|45.0|20/30|HHH| HM:PFM:REP 8->25|PF10391|0.0007|38.9|18/52|DNA_pol_lambd_f| RP:SCP:NREP 1 RP:SCP:REP 3->47|2q0zX1|4e-06|20.0|45/176|a.289.1.1| HM:SCP:REP 3->52|1szpA1|0.00065|32.0|50/64|a.60.4.1|1/1|Rad51 N-terminal domain-like| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---111111111111111-11111111-11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 84.9 SQ:SECSTR ##TccTTTHHHHHTTTcccHHHHHTccHHHHTTcTTccHHHHHHHHH###### DISOP:02AL 1-2,51-51| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccc //