[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55437.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  118/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:662 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->181 PF02687 * FtsX 5.4e-17 25.2 127/175  
:HMM:PFM   498->659 PF02687 * FtsX 1.5e-12 19.3 161/175  
:BLT:SWISS 35->297,470->611 BCEB_BACSU 5e-15 21.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55437.1 GT:GENE ACF55437.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 814272..816260 GB:FROM 814272 GB:TO 816260 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF02687 GB:PROTEIN_ID ACF55437.1 GB:DB_XREF GI:194356989 LENGTH 662 SQ:AASEQ MFRLTNKLAVSNLIKNRKLYYPFALAVLLAVTVTYLFYSLTFNPKIAEIRGGTTIQATLGFGMFVVTLASAIIVLYANSFVMKNRSKELGIYGMLGLEKRHLISMTFKELVVFGILTVGAGIGIGALFDKLIFAFLLKLMKLKVELVATFQMNVVIAVLVVFGLIFLGLMFLNALRIARMNALQLSREKASGEKRGRFLPLQTILGSISLGIGYYLALTVTDPLTALTTFFLAVLLVIFGTYLLFNAGITVFLQILKKNKKYYYQPNNLISVSNLIFRMKKNAVGLATIAILSTMVLVTMSAATSIFNSAESFKKVLNPHDFGVSGQNVEKEDLDKLLSQFASDKGYKIKEKEVLRYTYFAVANQEGTKLTIFEKGQNRVQPKTVFMVFDQKDYENMTGQKLSLSGNEVGLFAKNDGLKGQKALTLNDHQFSVKEEFNKDFIVNHVPNKFNILTTDYNYLVVPDLQAFLDQFPDSAIYNQFYGGMNVDASEEEQLKVAEEYENYLNQFNAQLDTEGSYVYGSNLADASSQMSALFGGVFFIGIFLSIIFMVGTVLVIYYKQISEGYXXRERFIILQKVGLDQKQIKQTINKQVLTVFFLPLLFAFIHLAFAYHMLSLILKVIGVLDTTMMLIVTLSICAIFLIAYVLIFMITSRSYRKIVQM GT:EXON 1|1-662:0| BL:SWS:NREP 1 BL:SWS:REP 35->297,470->611|BCEB_BACSU|5e-15|21.7|393/646| TM:NTM 10 TM:REGION 19->41| TM:REGION 57->79| TM:REGION 110->132| TM:REGION 149->171| TM:REGION 198->220| TM:REGION 230->252| TM:REGION 283->305| TM:REGION 536->558| TM:REGION 596->618| TM:REGION 634->656| SEG 24->34|alavllavtvt| SEG 136->143|llklmklk| SEG 154->172|vviavlvvfgliflglmfl| SEG 224->237|ltalttfflavllv| SEG 257->268|kknkkyyyqpnn| SEG 535->549|fggvffigiflsiif| HM:PFM:NREP 2 HM:PFM:REP 47->181|PF02687|5.4e-17|25.2|127/175|FtsX| HM:PFM:REP 498->659|PF02687|1.5e-12|19.3|161/175|FtsX| OP:NHOMO 204 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------333335352464545-----1646---11-112221112111111111111111-3311----22-------11111--11-11-11111-121111111111111-------------2221112221--1212223223141--11-11111111--1--11-----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 49-49,183-199,439-439,442-443| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEccccccEEccccccccccccccEEEEEcHHHHHHHccccccccccEEEEEEcHHHHccccEEEEcccEEEEEEEcccEEEcccccccccEEEcccEEEEEcHHHHHHHcccccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccc //