[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55441.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.115.1
:47 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->46 1jcuA  d.115.1.1 * 6e-06 20.9 %
:HMM:PFM   4->41 PF01300 * Sua5_yciO_yrdC 1.1e-05 32.4 37/179  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55441.1 GT:GENE ACF55441.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1124766..1124909) GB:FROM 1124766 GB:TO 1124909 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55441.1 GB:DB_XREF GI:194356993 LENGTH 47 SQ:AASEQ MTSDKAGLERKFAAKERKRNKPGVVLCGSMDELCALAQLNPEIEAFY GT:EXON 1|1-47:0| HM:PFM:NREP 1 HM:PFM:REP 4->41|PF01300|1.1e-05|32.4|37/179|Sua5_yciO_yrdC| RP:SCP:NREP 1 RP:SCP:REP 4->46|1jcuA|6e-06|20.9|43/208|d.115.1.1| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1------------1111-111-1-11--------------111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-18| PSIPRED cccHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHccHHHHHHc //