[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55446.1
DDBJ      :             oxalate:formate antiporter
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  326/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:408 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->363 1pw4A  f.38.1.1 * 9e-07 12.5 %
:HMM:SCOP  1->405 1pw4A_ f.38.1.1 * 5.8e-57 24.4 %
:HMM:PFM   18->361 PF07690 * MFS_1 4.9e-40 27.2 335/353  
:BLT:SWISS 4->360 OXLT_OXAFO 3e-27 31.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55446.1 GT:GENE ACF55446.1 GT:PRODUCT oxalate:formate antiporter GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1455731..1456957) GB:FROM 1455731 GB:TO 1456957 GB:DIRECTION - GB:PRODUCT oxalate:formate antiporter GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF55446.1 GB:DB_XREF GI:194356998 LENGTH 408 SQ:AASEQ MKSNRYIIAFAGVILHLMLGSTYAWSVYRNPIIEKTGWDQASVAFAFSLAIFCLGLSAAFMGRLVXKFGPRVMGSLSAFLYAGGNILTGFAIDRQELWLLYLAYGILGGLGLGAGYITPVSTIIKWFPDKRGLATGLAIMGFGFASLLTSPIAQHLIAGVGLVETFYILGASYFIIMLLASQFIKRPNEQELAILSASGKEKTDSLTQGMTANQALKSNRFYILWIIFFINIACGLGLISAASPMAQEMAGLSTSHAAVMVGVLGIFNGFGRLLWASLSDYIGRPLTFSILLLVNLLFSLSLWLFTDSVLFVVAMSILMTCYGAGFSLIPAYLSDIFGTKELAALHGYILTAWAMAGLAGPILLAETYKMAHSYTQTLFVFLILYSIALALSYYLGRSIKKESQKPLT GT:EXON 1|1-408:0| BL:SWS:NREP 1 BL:SWS:REP 4->360|OXLT_OXAFO|3e-27|31.4|344/418| TM:NTM 12 TM:REGION 4->26| TM:REGION 42->64| TM:REGION 71->93| TM:REGION 101->123| TM:REGION 132->154| TM:REGION 161->183| TM:REGION 220->242| TM:REGION 256->278| TM:REGION 284->306| TM:REGION 312->334| TM:REGION 346->367| TM:REGION 375->397| SEG 99->117|llylaygilgglglgagyi| SEG 286->305|ltfsilllvnllfslslwlf| SEG 382->395|lilysialalsyyl| HM:PFM:NREP 1 HM:PFM:REP 18->361|PF07690|4.9e-40|27.2|335/353|MFS_1| RP:SCP:NREP 1 RP:SCP:REP 1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1| HM:SCP:REP 1->405|1pw4A_|5.8e-57|24.4|402/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 502 OP:NHOMOORG 363 OP:PATTERN ------1-1111111--------2----1-----------------111------------11----- 12-----------------------2------------------1--1-----11--1------1-1211-----111--11---------------------1--------------------------------------------11--111----------------------------1----1-----22222222122222211221-2221111---111-111------------------------11111-1---1111-1-1-1-111111------111111211111111111111111---111---112---1111111-1-1-----------------221-2---1111------1----------12533--3311-1------------65654354----1111--12111133-----1-------------------2-----------------------------------1---1111-111-11----1133--------24533-3111--1------1146--111-11111111--------1---1---111---2121111-2222--221--------------------------11----------1--1------------1--------------11212111111111111-111111111111111111121111---1-11111111111111111111111-1----------------------------1111---1--------------1---------1111-1111-111----------11121111111111--11111111--------------------------------------------------------------- ----312-----131----1----1-1----------------------2-----1------------------------------------------------21-------------------------------------------------------------------2--------1--1---1--1-4664- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 398-409| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //