[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55454.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->44 1bazC PDBj 3e-04 18.2 %
:HMM:PFM   12->61 PF04180 * LTV 3.3e-05 31.2 48/421  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55454.1 GT:GENE ACF55454.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1093217..1093459) GB:FROM 1093217 GB:TO 1093459 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55454.1 GB:DB_XREF GI:194357006 LENGTH 80 SQ:AASEQ MTTITLKVSEADKTFMKAMAKFEGVSLSELIRTKTLEALEDEYDARVADLAYXEYLEDLEKGVEPITWEEMMHDLGLKDE GT:EXON 1|1-80:0| RP:PDB:NREP 1 RP:PDB:REP 1->44|1bazC|3e-04|18.2|44/46| HM:PFM:NREP 1 HM:PFM:REP 12->61|PF04180|3.3e-05|31.2|48/421|LTV| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------1----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 55.0 SQ:SECSTR cccccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHTTc#################################### DISOP:02AL 1-1,79-81| PSIPRED ccEEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccc //