[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55472.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.43.2
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->131 3bk6C PDBj 2e-12 21.7 %
:RPS:SCOP  1->134 1winA  d.43.2.1 * 9e-12 16.9 %
:HMM:SCOP  15->136 1winA_ d.43.2.1 * 1.1e-07 25.5 %
:RPS:PFM   15->138 PF01145 * Band_7 2e-06 31.5 %
:HMM:PFM   15->138 PF01145 * Band_7 3.5e-14 25.9 108/179  
:BLT:SWISS 75->179 PHB1_YEAST 5e-07 25.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55472.1 GT:GENE ACF55472.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1958776..1959366 GB:FROM 1958776 GB:TO 1959366 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55472.1 GB:DB_XREF GI:194357024 LENGTH 196 SQ:AASEQ MTLSNSRQKINDCLGNPVEIGIAVTWRVVDTAKAVFNVDNYKEYLSLQCDSALRNIVRIYPYDVSPNVDTTGDGQADEGSLRGSSEIVANRIREEIQSRVEDAGLEILEARITYLAYAPEIAAVMLQRQQASAIIDARKMIVDGAVGMVEMALERLNEGELVELDEERKAAMVSNLLVVLCGNHDAQPIVNTGSLY GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 75->179|PHB1_YEAST|5e-07|25.7|105/287| RP:PDB:NREP 1 RP:PDB:REP 1->131|3bk6C|2e-12|21.7|115/160| RP:PFM:NREP 1 RP:PFM:REP 15->138|PF01145|2e-06|31.5|108/183|Band_7| HM:PFM:NREP 1 HM:PFM:REP 15->138|PF01145|3.5e-14|25.9|108/179|Band_7| RP:SCP:NREP 1 RP:SCP:REP 1->134|1winA|9e-12|16.9|118/143|d.43.2.1| HM:SCP:REP 15->136|1winA_|1.1e-07|25.5|106/0|d.43.2.1|1/1|Band 7/SPFH domain| OP:NHOMO 120 OP:NHOMOORG 117 OP:PATTERN -------------------------------------------------------------------- ----1-11111-------------------------1------1--------------------1-12221-------1-1---------11-1---------1-1-1--------------------------------------1-------------------------------------1-------1-111111111111111------111111-1---------1--------------------1-1--------1111---------------------11111111111-------------------------1------------11---------1-11---111-----1--------1--1---------------------------------11-11-1------------------------------------------------11111111-----------------1-11-1111--------------------------------------------------------------------------------------------------------------------------------------1--1----1--------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-------------------------------------------------------------1- ------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 58.7 SQ:SECSTR EEEEEEEEEEEcTTccEEEEEEEEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHccHH################HHHHcHHHHHHHHHHHHHHHTGGGTEEEEEEEEEEEEccTTHHHHHHHHHHH################################################################# DISOP:02AL 1-4,131-132| PSIPRED ccccccccEEEcccccEEEEEEEEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcEEEEEcccccccEEcccccc //