[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55476.1
DDBJ      :             uracil-DNA glycosylase
Swiss-Prot:UNG_STRR6    RecName: Full=Uracil-DNA glycosylase;         Short=UDG;         EC=3.2.2.-;

Homologs  Archaea  0/68 : Bacteria  629/915 : Eukaryota  182/199 : Viruses  1/175   --->[See Alignment]
c.18.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->215 2booA PDBj 3e-60 53.6 %
:RPS:PDB   3->215 1akzA PDBj 7e-84 49.8 %
:RPS:SCOP  3->215 1akzA  c.18.1.1 * 4e-84 49.8 %
:HMM:SCOP  4->215 3eugA_ c.18.1.1 * 2.3e-85 56.6 %
:RPS:PFM   55->202 PF03167 * UDG 2e-13 51.2 %
:HMM:PFM   52->206 PF03167 * UDG 3.1e-28 34.1 132/150  
:BLT:SWISS 1->217 UNG_STRR6 e-123 100.0 %
:PROS 55->64|PS00130|U_DNA_GLYCOSYLASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55476.1 GT:GENE ACF55476.1 GT:PRODUCT uracil-DNA glycosylase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1046197..1046850) GB:FROM 1046197 GB:TO 1046850 GB:DIRECTION - GB:PRODUCT uracil-DNA glycosylase GB:NOTE identified by match to protein family HMM PF03167; match to protein family HMM TIGR00628 GB:PROTEIN_ID ACF55476.1 GB:DB_XREF GI:194357028 LENGTH 217 SQ:AASEQ MEHSSWHALIKAQLPEGYFGKINQFMEQVYSQGIIYPPKEKVFQALLTTLLEEVKVVILGQDPYHGPGQAQGLSFSVPDSIPAPPSLQNILKELSDDIGVKKSHDLTAWAEQGVLLLNACLTVPAGQANGHAGQIWEPFTDAVIQVVNHLDRPVVFVLWGAYARKKKALVTNPHHLIIESAHPSPLSVYRGFWGSKPFSKANTFLKETGQEPIDWLR GT:EXON 1|1-217:0| SW:ID UNG_STRR6 SW:DE RecName: Full=Uracil-DNA glycosylase; Short=UDG; EC=3.2.2.-; SW:GN Name=ung; OrderedLocusNames=spr1055; SW:KW Complete proteome; Cytoplasm; DNA damage; DNA repair; Glycosidase;Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->217|UNG_STRR6|e-123|100.0|217/217| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 55->64|PS00130|U_DNA_GLYCOSYLASE|PDOC00121| SEG 46->53|llttllee| BL:PDB:NREP 1 BL:PDB:REP 6->215|2booA|3e-60|53.6|209/230| RP:PDB:NREP 1 RP:PDB:REP 3->215|1akzA|7e-84|49.8|213/223| RP:PFM:NREP 1 RP:PFM:REP 55->202|PF03167|2e-13|51.2|125/147|UDG| HM:PFM:NREP 1 HM:PFM:REP 52->206|PF03167|3.1e-28|34.1|132/150|UDG| RP:SCP:NREP 1 RP:SCP:REP 3->215|1akzA|4e-84|49.8|213/223|c.18.1.1| HM:SCP:REP 4->215|3eugA_|2.3e-85|56.6|212/225|c.18.1.1|1/1|Uracil-DNA glycosylase-like| OP:NHOMO 884 OP:NHOMOORG 812 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111---11111111111111111111111122211111111----------221112111--111111111-1111111111111111-------------------1-1------------------------------------111------11111111111111111111111111111111122222211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-------1-1-1---1111--11-11--11-------------11-------------------------------------11111111---1111111111111-------1----11-----------------------------------------------1111-1111111111111111111111111111111111111111111111112----111111111111------1---1--1---111-1-1-----1----11--1111111111111111111111-----1111111111121111111111111111111-1-----11-1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111-----11111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--11----11111111--111111-1111111111111111111------------- 1111221-311-111111111111111111111111111111111111111111-111111111111111111111111111111111-11211221111111111112241111111-111213312-372-222-11111111111--1111111-12231221-----2111111181111151-11132221114 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 214 STR:RPRED 98.6 SQ:SECSTR ##cHHHHHHHHHHHTcHHHHHHHHHHHHHHHHccEEccGGGTTGGGTcccGGGccEEEEEccccccTTTccccTTcccTTccccHHHHHHHHHHHHHcTcccccccHHHHHTTEEEEEccccEETTcTTTTTTccHHHHHHHHHHHHHHHccccEEEEEcHHHHHHGGGccTTTcEEEEEccccTTTGGGTTTTccHHHHHHHHHHHTTcccccTc# DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHcEEEEEccccccccccccEEEEcccccccccHHHHHHHHHHHHHccccccccccHHHHHcccHHccEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcccccEEEEEEccccccccccccccccHHHHHHHHHHHcccccccccc //