[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55490.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->52 PF07929 * PRiA4_ORF3 2.5e-05 24.1 29/179  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55490.1 GT:GENE ACF55490.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1963831..1963995) GB:FROM 1963831 GB:TO 1963995 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55490.1 GB:DB_XREF GI:194357042 LENGTH 54 SQ:AASEQ MDNVEWSHADSYFLSFVSDDVEERYIENVYLDSLSVKQKFKFIFDFGDEWRFEC GT:EXON 1|1-54:0| HM:PFM:NREP 1 HM:PFM:REP 24->52|PF07929|2.5e-05|24.1|29/179|PRiA4_ORF3| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHEEccccEEEcc //