[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55494.1
DDBJ      :             peptidase, S54 (rhomboid) family protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  239/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
f.51.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->183 2nr9A PDBj 8e-09 27.6 %
:RPS:SCOP  38->190 2ic8A1  f.51.1.1 * 2e-20 20.7 %
:HMM:SCOP  4->197 2nr9A1 f.51.1.1 * 1.2e-35 37.8 %
:RPS:PFM   57->189 PF01694 * Rhomboid 8e-16 40.5 %
:HMM:PFM   55->190 PF01694 * Rhomboid 1.6e-37 34.1 135/146  
:BLT:SWISS 39->190 RHBL3_TOXGO 9e-17 28.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55494.1 GT:GENE ACF55494.1 GT:PRODUCT peptidase, S54 (rhomboid) family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1916153..1916830) GB:FROM 1916153 GB:TO 1916830 GB:DIRECTION - GB:PRODUCT peptidase, S54 (rhomboid) family protein GB:NOTE identified by match to protein family HMM PF01694 GB:PROTEIN_ID ACF55494.1 GB:DB_XREF GI:194357046 LENGTH 225 SQ:AASEQ MKEIFDRRYPVTSFFLLVTALVFLLMLVTAGGNFDRADTLFRFGAMYGPAIRLFPEQIWRLLSAIFVHIGWEHFIVNMLSLYYLGRQVEEIFGSKQFFFLYLLSGMMGNLFVFVFSPKSLAAGASTSLYGLFAAIIILRYATRNPYIQQLGQSYLTLFVVNIIGSVLIPGISLAGHIGGAVGGAFLAVIFPVRGEKRMYNTSQRLGAVVLFVGLAILLFYKGMGM GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 39->190|RHBL3_TOXGO|9e-17|28.7|150/263| TM:NTM 6 TM:REGION 11->33| TM:REGION 60->82| TM:REGION 94->116| TM:REGION 121->143| TM:REGION 162->184| TM:REGION 203->225| SEG 11->29|vtsffllvtalvfllmlvt| BL:PDB:NREP 1 BL:PDB:REP 46->183|2nr9A|8e-09|27.6|134/192| RP:PFM:NREP 1 RP:PFM:REP 57->189|PF01694|8e-16|40.5|131/146|Rhomboid| HM:PFM:NREP 1 HM:PFM:REP 55->190|PF01694|1.6e-37|34.1|135/146|Rhomboid| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01694|IPR002610| GO:PFM GO:0016021|"GO:integral to membrane"|PF01694|IPR002610| RP:SCP:NREP 1 RP:SCP:REP 38->190|2ic8A1|2e-20|20.7|150/182|f.51.1.1| HM:SCP:REP 4->197|2nr9A1|1.2e-35|37.8|185/0|f.51.1.1|1/1|Rhomboid-like| OP:NHOMO 391 OP:NHOMOORG 346 OP:PATTERN --1--1--1111111-1------------------1-------------1-1-1111111----1--- -11-2-1-11111-1--11-11--111111111111--111----11---1--11-111111121-11--1-----11---11-------1-------------1---11-------------------------1-1122---1-111-11-------------------------------------1-111--------1------222222---22112-1111111--1111111111111111111111111111111111111-1-11-11111111-11111111111111111111111111111111111111---11-------1-11----111--11---1--11--1-----1------1-------------1-----------------------------------------11--------------------------------------------------------------------1-----------------------------------------------------1-------------1------------------1-1----1------1-------1111---------------1--------------1121------1-1--1-1--------------------------------------------------------1------------------------------------------------------------------------11111-1--1-1-------1---------------------------------------------------11--11------------------------------------2111111111-11 11-1112-1-----1-1-1--------1-11-1---11111-------111111----1--1-11----1--111------11111-----111-1----11-1-1--11-11121------1-211--------1-----1----1----1--1--11111-------1-12--2111C-1-23222315-22----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 62.7 SQ:SECSTR #############################################HcccccGGGGGcTTHHHHGGGccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccc#cccHHHHHHHHHHHHH##HHHccTTccccccccTTTTTTTTTHHHHccccTTHHHHHHHHHHHHHHHH#################################### DISOP:02AL 1-2| PSIPRED cccHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //