[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55498.1
DDBJ      :             CAAX amino terminal protease family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   122->208 PF02517 * Abi 2e-05 34.5 %
:HMM:PFM   122->212 PF02517 * Abi 1.2e-21 37.4 91/99  
:BLT:SWISS 112->208 YPBD_BACSU 3e-07 26.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55498.1 GT:GENE ACF55498.1 GT:PRODUCT CAAX amino terminal protease family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 828361..829032 GB:FROM 828361 GB:TO 829032 GB:DIRECTION + GB:PRODUCT CAAX amino terminal protease family GB:NOTE identified by match to protein family HMM PF02517 GB:PROTEIN_ID ACF55498.1 GB:DB_XREF GI:194357050 LENGTH 223 SQ:AASEQ MKKRAIQILLALSLIFYKSTWFWRLFNYLAKPYLPASREFFQILLLMESGVLLLAVIYLLVFAGKKTFHFKWQLRYFIYLLLGYITSYMSDFLFSYFISLSSNQISLNETIEMIGRQELPYFLLIVCFIGPIAEELIYRGVLMTTFFKNSPWYGDVLLSAIIFGYIHINFALTPLAFFIYASGGLILALLYRMTKNIYYPILVHILINITAFWDVWLLLFSGS GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 112->208|YPBD_BACSU|3e-07|26.1|88/189| TM:NTM 6 TM:REGION 5->27| TM:REGION 39->61| TM:REGION 123->145| TM:REGION 151->173| TM:REGION 176->198| TM:REGION 201->223| RP:PFM:NREP 1 RP:PFM:REP 122->208|PF02517|2e-05|34.5|87/97|Abi| HM:PFM:NREP 1 HM:PFM:REP 122->212|PF02517|1.2e-21|37.4|91/99|Abi| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02517|IPR003675| OP:NHOMO 151 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------2144444132132411211111112211--1--111111---------1-------1111--11-11-1--1-111221-211----11--111---44454355335-------------2-----------------1-21-2-----------1-------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //