[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55500.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y223_STRP4   RecName: Full=UPF0210 protein SPG_0223;

Homologs  Archaea  27/68 : Bacteria  132/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.7.1
:445 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->440 2ha9A PDBj e-171 94.9 %
:RPS:SCOP  2->440 2ha9A1  c.7.1.5 * e-169 93.2 %
:RPS:PFM   2->409 PF05167 * DUF711 e-132 74.9 %
:HMM:PFM   11->430 PF05167 * DUF711 1.5e-177 69.8 394/399  
:BLT:SWISS 1->445 Y223_STRP4 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55500.1 GT:GENE ACF55500.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 207961..209298 GB:FROM 207961 GB:TO 209298 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF05167 GB:PROTEIN_ID ACF55500.1 GB:DB_XREF GI:194357052 LENGTH 445 SQ:AASEQ MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSVARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAVQNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIPKGKEGDMIEFGGLLGTAPVMRVNGASSVDFISRGGQIPAPIHSFKN GT:EXON 1|1-445:0| SW:ID Y223_STRP4 SW:DE RecName: Full=UPF0210 protein SPG_0223; SW:GN OrderedLocusNames=SPG_0223; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->445|Y223_STRP4|0.0|100.0|445/445| SEG 95->104|lakaldkaak| BL:PDB:NREP 1 BL:PDB:REP 2->440|2ha9A|e-171|94.9|396/397| RP:PFM:NREP 1 RP:PFM:REP 2->409|PF05167|e-132|74.9|407/418|DUF711| HM:PFM:NREP 1 HM:PFM:REP 11->430|PF05167|1.5e-177|69.8|394/399|DUF711| RP:SCP:NREP 1 RP:SCP:REP 2->440|2ha9A1|e-169|93.2|412/413|c.7.1.5| OP:NHOMO 168 OP:NHOMOORG 161 OP:PATTERN ---1-12--------1-122222------------11111111--111-11111----------1--- --1--111111111----------------------------------------------------1----11111111111---------------------------------------------------------11----------------------------1-------------------------------------------------------111111-------------------------11111-1-111111-1-111111----11111111-11111111-------------111111111111-11-------1-11111111-1111--111111111-1-111--1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-------11-11111-----1-------11-------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--------------------------------------------------------------------------------------------------------------------------------------- ------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 394 STR:RPRED 88.5 SQ:SECSTR #cHHHHHHHHH#HHHccccEEEEE#EEccGGGccccHHHHHHHHHHHHHHHTTTHHHHHHHHHHHHTccEEEEEEEEccHHHHHHTccccccHHHHHHHHHHHHHHTccEEEEEEEEcTTcccTTHHHHHHHHHHHHHccccEEEEEEcEETTTEEE#HHHHH#HHHHHHHHTTcc#GGGGEEEEEcccTTccc#ccccccTTcccEEEEEEEccHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHHHHH#HHHHHTcEEEEEccccccc##ccccHHHHHHH#HcccTTcTTHHHHHHHHHHHHHHHHH#Tccc############ccHH#HHHHHTTcccHHHHHH#TTccc####cEEEc#TTccHHHHHHHHHHHHHHHHH#ccEEEEEEEcccTTc#ccc#####cccc#cccccccHHHHHTc############ DISOP:02AL 1-2,441-442,444-446| PSIPRED ccHHHHHHHHHHHHHccccEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccHHHEEEEEccccccccccccccccccccEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccEEEEccccEEEEEEEcccccHHHHHHcccccccccccccc //