[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55504.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->71 PF04226 * Transgly_assoc 5e-13 48.7 39/48  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55504.1 GT:GENE ACF55504.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 254684..254914 GB:FROM 254684 GB:TO 254914 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF04226 GB:PROTEIN_ID ACF55504.1 GB:DB_XREF GI:194357056 LENGTH 76 SQ:AASEQ MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLFGTWGPVLSGTAIIPAILGAMIVLAIFWRRGS GT:EXON 1|1-76:0| TM:NTM 3 TM:REGION 1->20| TM:REGION 26->48| TM:REGION 51->72| HM:PFM:NREP 1 HM:PFM:REP 31->71|PF04226|5e-13|48.7|39/48|Transgly_assoc| OP:NHOMO 97 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111----1-111-1--------------------1------------2-2-11-----11-------3211-1111211111111111-2111122222222222221112221111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,76-77| PSIPRED cHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHccc //