[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55508.1
DDBJ      :             flavodoxin
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  329/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:147 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->124 1j9eA PDBj 4e-17 34.1 %
:RPS:PDB   1->140 2bn4A PDBj 3e-24 21.4 %
:RPS:SCOP  6->145 1ykgA1  c.23.5.2 * 3e-24 26.4 %
:HMM:SCOP  1->146 1oboA_ c.23.5.1 * 7.5e-39 36.8 %
:RPS:PFM   6->116 PF00258 * Flavodoxin_1 2e-13 41.8 %
:HMM:PFM   6->133 PF00258 * Flavodoxin_1 1.5e-27 33.9 127/143  
:BLT:SWISS 1->144 FLAV_BACSU 2e-28 42.4 %
:PROS 6->22|PS00201|FLAVODOXIN

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55508.1 GT:GENE ACF55508.1 GT:PRODUCT flavodoxin GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1163022..1163465) GB:FROM 1163022 GB:TO 1163465 GB:DIRECTION - GB:PRODUCT flavodoxin GB:NOTE identified by match to protein family HMM PF00258; match to protein family HMM TIGR01753 GB:PROTEIN_ID ACF55508.1 GB:DB_XREF GI:194357060 LENGTH 147 SQ:AASEQ MALAKIVFASMTGNTEEIADIVADKLRDLGLDVDVDECTTVDASDFLEADIAIVATYTYGDGELPDEMMDFYEDLADLNLNGKXYGVVGSGDTFYDEFCKAVDDFDRVFVSTGAEKGSECVKVDLSAEEEDIERLEQFAEELVAKVG GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 1->144|FLAV_BACSU|2e-28|42.4|144/158| PROS 6->22|PS00201|FLAVODOXIN|PDOC00178| BL:PDB:NREP 1 BL:PDB:REP 2->124|1j9eA|4e-17|34.1|123/147| RP:PDB:NREP 1 RP:PDB:REP 1->140|2bn4A|3e-24|21.4|140/643| RP:PFM:NREP 1 RP:PFM:REP 6->116|PF00258|2e-13|41.8|110/137|Flavodoxin_1| HM:PFM:NREP 1 HM:PFM:REP 6->133|PF00258|1.5e-27|33.9|127/143|Flavodoxin_1| GO:PFM:NREP 2 GO:PFM GO:0010181|"GO:FMN binding"|PF00258|IPR008254| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00258|IPR008254| RP:SCP:NREP 1 RP:SCP:REP 6->145|1ykgA1|3e-24|26.4|140/146|c.23.5.2| HM:SCP:REP 1->146|1oboA_|7.5e-39|36.8|144/0|c.23.5.1|1/1|Flavoproteins| OP:NHOMO 410 OP:NHOMOORG 330 OP:PATTERN --------------------------------------------------1----------------- --------------1------1----------11111-22-----------------------------------1---------------1----------------------------------1---------------------1-------------------------------------------22222222221222222113333222--11-2211111122-11111111111111111122121221111122222211111111111111111111111111111111111111111111111111111-1-----------------------------------------------1------------------1------------------11-11111---------------------------------------------------------------------------------1-----1111111----1111------111------------------------1-----121111-----1-------1111111----------------------1--------------------1121-2--11122211112-211111112132-------------2122112111-1-1-11-111111-1111-211111133322222111111111111111111111111--3111111111111111--------------222212111111111-----------111-1-1-21111---------------1--11111111111------------------11--------------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR TccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEETTTccGGGGGGccEEEEEEEccTTTccccccHHHHHHHHHccTTTcEEEEEEEEcTTcccTTHHHHHHHHHHHHTTcEEccccEEEEGGGTcHHHHHHHHHHHHHEcTcT PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEHHHccHHHcccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEcccEEEEEcccccHHHHHHHHHHHHHHHHc //