Streptococcus pneumoniae G54 (spne4)
Gene : ACF55516.1
DDBJ      :             conserved hypothetical protein

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55516.1 GT:GENE ACF55516.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 626063..626413 GB:FROM 626063 GB:TO 626413 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55516.1 GB:DB_XREF GI:194357068 LENGTH 116 SQ:AASEQ MFLPTVLARQIGNYDLTLPRWGSDTTSELEKENASAGINNSDSTGGGKRLSTSIRSAYSGSDITPVYSLGSGSRIVMYYNGGGDNYIGSGTRLAMAPQFGNHVRIHTSGSWSPDSY GT:EXON 1|1-116:0| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 34-45,110-117| PSIPRED ccHHHHHHHHHcccEEEEEEEccccccEEEEEEcccccccccccccccEEEHHHHcccccccccEEEEcccccEEEEEEEcccccccccccEEEEccccccEEEEEEccccccccc //