[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55526.1
DDBJ      :             Tn5253 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->65 PF04692 * PDGF_N 0.00029 26.0 50/78  
:BLT:SWISS 14->81 RH5_ORYSJ 3e-04 30.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55526.1 GT:GENE ACF55526.1 GT:PRODUCT Tn5253 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1224688..1224963) GB:FROM 1224688 GB:TO 1224963 GB:DIRECTION - GB:PRODUCT Tn5253 hypothetical protein GB:PROTEIN_ID ACF55526.1 GB:DB_XREF GI:194357078 LENGTH 91 SQ:AASEQ MFTTFFKKNHDNSDVFKKLIHRLSDMSVQDLEKIDRLLDIIFTPDQESEQVKTESIYREETLDDTLKEAKNQLHKEQLEKNLERFRKDGRK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 14->81|RH5_ORYSJ|3e-04|30.9|68/100| HM:PFM:NREP 1 HM:PFM:REP 16->65|PF04692|0.00029|26.0|50/78|PDGF_N| OP:NHOMO 13 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1------111-1--1--------------11---2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,7-7,47-60,71-72,75-75,81-84,86-92| PSIPRED cHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //