[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55534.1
DDBJ      :             response regulator TCS09
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  815/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1c.23.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->117 3cu5B PDBj 3e-19 36.3 %
:BLT:PDB   147->242 2k9sA PDBj 8e-18 40.6 %
:RPS:PDB   1->57 2dvyD PDBj 7e-08 11.1 %
:RPS:PDB   32->117 3cwoX PDBj 7e-24 24.4 %
:RPS:PDB   149->241 1bl0A PDBj 1e-19 26.1 %
:RPS:SCOP  5->120 1a0oA  c.23.1.1 * 2e-21 25.4 %
:RPS:SCOP  145->241 1v4aA1  a.24.16.4 * 2e-16 15.6 %
:HMM:SCOP  2->138 1s8nA_ c.23.1.1 * 7.6e-34 32.8 %
:HMM:SCOP  142->192 1bl0A1 a.4.1.8 * 9.7e-06 33.3 %
:HMM:SCOP  193->242 1d5yA2 a.4.1.8 * 3.1e-13 46.0 %
:RPS:PFM   5->120 PF00072 * Response_reg 2e-21 43.6 %
:RPS:PFM   202->240 PF00165 * HTH_AraC 1e-07 51.3 %
:HMM:PFM   5->116 PF00072 * Response_reg 4.7e-31 35.5 110/112  
:HMM:PFM   149->190 PF00165 * HTH_AraC 2.5e-08 34.1 41/42  
:HMM:PFM   203->239 PF00165 * HTH_AraC 1.5e-09 47.2 36/42  
:BLT:SWISS 3->241 Y217_STAA3 3e-27 29.2 %
:PROS 194->236|PS00041|HTH_ARAC_FAMILY_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55534.1 GT:GENE ACF55534.1 GT:PRODUCT response regulator TCS09 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 593061..593798 GB:FROM 593061 GB:TO 593798 GB:DIRECTION + GB:PRODUCT response regulator TCS09 GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00165 GB:PROTEIN_ID ACF55534.1 GB:DB_XREF GI:194357086 LENGTH 245 SQ:AASEQ MTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELIQKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYLLKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQFSLKSLASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKVGFEDMNYFTQRFKQIAGVTPRQFKKGEDR GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 3->241|Y217_STAA3|3e-27|29.2|236/252| PROS 194->236|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| SEG 121->137|kqkldkeekeeqlqdll| BL:PDB:NREP 2 BL:PDB:REP 5->117|3cu5B|3e-19|36.3|113/129| BL:PDB:REP 147->242|2k9sA|8e-18|40.6|96/107| RP:PDB:NREP 3 RP:PDB:REP 1->57|2dvyD|7e-08|11.1|54/214| RP:PDB:REP 32->117|3cwoX|7e-24|24.4|86/236| RP:PDB:REP 149->241|1bl0A|1e-19|26.1|92/116| RP:PFM:NREP 2 RP:PFM:REP 5->120|PF00072|2e-21|43.6|110/111|Response_reg| RP:PFM:REP 202->240|PF00165|1e-07|51.3|39/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 5->116|PF00072|4.7e-31|35.5|110/112|Response_reg| HM:PFM:REP 149->190|PF00165|2.5e-08|34.1|41/42|HTH_AraC| HM:PFM:REP 203->239|PF00165|1.5e-09|47.2|36/42|HTH_AraC| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 5->120|1a0oA|2e-21|25.4|114/128|c.23.1.1| RP:SCP:REP 145->241|1v4aA1|2e-16|15.6|96/151|a.24.16.4| HM:SCP:REP 2->138|1s8nA_|7.6e-34|32.8|134/190|c.23.1.1|1/1|CheY-like| HM:SCP:REP 142->192|1bl0A1|9.7e-06|33.3|51/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 193->242|1d5yA2|3.1e-13|46.0|50/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 6995 OP:NHOMOORG 859 OP:PATTERN -----------------------4-----112---1--1211241-28-32-5-2-2111-------- 8IL5H42533351653444-4622684444457777BA7B374A87424633585235113598D78JFJ1222272242424-3446IJZP-8-----57O5C9s9a8F1------1--11111---23123352MKLOMB78X7SGJFAA67645232334CA6ARQP92224222224227832254178IFFFFFFHGBHDGHGEQUJJGIFLKCIHNCB698798Ah*6999999789999997778694214412123332288347-4412279886567558887888888866666666676667452335554IUHEgGGGGHIGAGAMA9967A7aAD-59AA67PRIFBC9999859L146EG922213122186B844283456144443444434-54344375-4319666752BE7875543345121124454444444413213D37----------11-----------------12265233314ECCEDE7ABBAAACHBBCC7BEEBAGCB-1454B8532748C549A46C5661111111153396D7ceJ7AQF3KLHHI1TRWSNTZCEFGNJFCHKG363-232332132122221BH63811CABBAHD5C96BBBCB99DBCC9CDEEADI--26735------C955576BBBDBBDECB-BDBBBDEBBDBCCABBBBCEDG87456A76999999A89A9996B97AABB3-766666666666--2511111232353O2F2222121111112217765737243599ABACGHFGBACJ8FGF-----1---68DDIEEEEEEGHGG78B8A995682222--745656331111111142--------------------------23343443245Q2 ----11--------2--------------------------------------------------11--------------------------11-111-11--------------------------------------------------------2--------------4--2---1-1--M--3-11--4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 89.8 SQ:SECSTR cccEEEEEcccHHHHHHHHHHHHHHcccEEEEEccccccTTHHHHHHHccccEEEEcccTTccHHHHHHHHHHHcccccEEEEccccTHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHH#########################HHHHHTTTTcHccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTTccc DISOP:02AL 1-1,127-136,238-246| PSIPRED cccEEEEEcccHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHcc //