[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55535.1
DDBJ      :             6,7-dimethyl-8-ribityllumazine synthase
Swiss-Prot:RISB_STRZT   RecName: Full=6,7-dimethyl-8-ribityllumazine synthase;         Short=DMRL synthase;         Short=Lumazine synthase;         EC=2.5.1.9;AltName: Full=Riboflavin synthase beta chain;

Homologs  Archaea  52/68 : Bacteria  779/915 : Eukaryota  105/199 : Viruses  0/175   --->[See Alignment]
c.16.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->154 1rvvA PDBj 6e-57 66.9 %
:RPS:PDB   4->155 1c41A PDBj 3e-39 36.8 %
:RPS:SCOP  12->155 1di0A  c.16.1.1 * 7e-58 29.9 %
:HMM:SCOP  1->155 1ejbA_ c.16.1.1 * 1.5e-62 57.4 %
:RPS:PFM   10->151 PF00885 * DMRL_synthase 4e-50 63.4 %
:HMM:PFM   11->152 PF00885 * DMRL_synthase 1.6e-65 63.4 142/144  
:BLT:SWISS 1->155 RISB_STRZT 4e-85 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55535.1 GT:GENE ACF55535.1 GT:PRODUCT 6,7-dimethyl-8-ribityllumazine synthase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(167410..167877) GB:FROM 167410 GB:TO 167877 GB:DIRECTION - GB:PRODUCT 6,7-dimethyl-8-ribityllumazine synthase GB:NOTE identified by match to protein family HMM PF00885; match to protein family HMM TIGR00114 GB:PROTEIN_ID ACF55535.1 GB:DB_XREF GI:194357087 LENGTH 155 SQ:AASEQ MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNEKDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQISLNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA GT:EXON 1|1-155:0| SW:ID RISB_STRZT SW:DE RecName: Full=6,7-dimethyl-8-ribityllumazine synthase; Short=DMRL synthase; Short=Lumazine synthase; EC=2.5.1.9;AltName: Full=Riboflavin synthase beta chain; SW:GN Name=ribH; OrderedLocusNames=SPT_0212; SW:KW Complete proteome; Riboflavin biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|RISB_STRZT|4e-85|100.0|155/155| GO:SWS:NREP 2 GO:SWS GO:0009231|"GO:riboflavin biosynthetic process"|Riboflavin biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->154|1rvvA|6e-57|66.9|154/154| RP:PDB:NREP 1 RP:PDB:REP 4->155|1c41A|3e-39|36.8|152/165| RP:PFM:NREP 1 RP:PFM:REP 10->151|PF00885|4e-50|63.4|142/143|DMRL_synthase| HM:PFM:NREP 1 HM:PFM:REP 11->152|PF00885|1.6e-65|63.4|142/144|DMRL_synthase| GO:PFM:NREP 2 GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF00885|IPR002180| GO:PFM GO:0009349|"GO:riboflavin synthase complex"|PF00885|IPR002180| RP:SCP:NREP 1 RP:SCP:REP 12->155|1di0A|7e-58|29.9|144/148|c.16.1.1| HM:SCP:REP 1->155|1ejbA_|1.5e-62|57.4|155/168|c.16.1.1|1/1|Lumazine synthase| OP:NHOMO 990 OP:NHOMOORG 936 OP:PATTERN 11-11-1111111111--1111-11--1-1--1111111111111111111111-1-111-1--1-11 1111111111111111111-1111121111111111222211121-111111111111111111-111111----1-----11111111111-111---1111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111---1111111111111111111111111111111111------1111111111111111111111--1----1---1111----111-111111-------11111111111-----------------------11-11111111111111111111-111--1111111111211111-1-111111222111111-2221111212122222222222-111111111211111211211122--111112111111211111111111111111111111111---------------111111111111111111111111111111111111211111111111111112111212111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111111222111111111111111111111111111111111111111111111111------------------------------------11-111-111111 ------1-----111--1111111-1-11111111-11-111111111111111111111111111111-11-11111111111-111-111-11111111-1112-12------------------------------------------------------1---------1-111----1-12122111111222- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccEEEEEEcTTHHHHHHHHHHHHHHHHHTTccGGGEEEEEEccTTHHHHHHHHHHHHHcccEEEEEEEEEccccTHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEccHHHHHHHTTccTTcHHHHHHHHHHHHHHHHHHHHT DISOP:02AL 155-156| PSIPRED cEEEEcccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHccccHHHEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHccc //