[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55552.1
DDBJ      :             Glucokinase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  415/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:294 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->285 2qm1B PDBj 7e-16 27.4 %
:RPS:PDB   3->285 2aa4A PDBj 1e-37 20.7 %
:RPS:SCOP  7->120 2gupA1  c.55.1.10 * 1e-28 34.6 %
:RPS:SCOP  158->290 2gupA2  c.55.1.10 * 2e-21 30.8 %
:HMM:SCOP  1->292 1sz2A1 c.55.1.7 * 1e-54 31.8 %
:RPS:PFM   7->162 PF00480 * ROK 2e-19 35.3 %
:HMM:PFM   6->167 PF00480 * ROK 7.7e-37 36.1 158/179  
:BLT:SWISS 1->290 Y188_CLOPE 2e-74 49.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55552.1 GT:GENE ACF55552.1 GT:PRODUCT Glucokinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1526326..1527210) GB:FROM 1526326 GB:TO 1527210 GB:DIRECTION - GB:PRODUCT Glucokinase GB:NOTE identified by match to protein family HMM PF00480 GB:PROTEIN_ID ACF55552.1 GB:DB_XREF GI:194357104 LENGTH 294 SQ:AASEQ MTYYVAIDIGGTNIKYGLVDQEGQLLESHEMPTEAHKGGPHILQKTKDIVASYLEKGPVAGVAISSAGMVDPDKGEIFYAGPQIPNYAGTQFKKEIEESFTIPCEIENDVNCAGLAEAVSGSGKGASVTLCLTIGTGIGGCLIMDRKVFHGFSNSACEVGYMHMQDGAFQDLASTTALVKYVAEAHGEDVDQWNGRRIFKEATEGNKICMEGIDRMVDYLGKGLANICYVANPEVVILGGGIMGQEAILKPKIRTALKEALVPSLAEKTRLEFAHHQNTAGMLGAYYHFKTKQS GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 1->290|Y188_CLOPE|2e-74|49.7|290/295| SEG 129->143|tlcltigtgiggcli| BL:PDB:NREP 1 BL:PDB:REP 5->285|2qm1B|7e-16|27.4|277/321| RP:PDB:NREP 1 RP:PDB:REP 3->285|2aa4A|1e-37|20.7|275/289| RP:PFM:NREP 1 RP:PFM:REP 7->162|PF00480|2e-19|35.3|153/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 6->167|PF00480|7.7e-37|36.1|158/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 7->120|2gupA1|1e-28|34.6|104/114|c.55.1.10| RP:SCP:REP 158->290|2gupA2|2e-21|30.8|130/175|c.55.1.10| HM:SCP:REP 1->292|1sz2A1|1e-54|31.8|280/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 852 OP:NHOMOORG 468 OP:PATTERN ----------------1----------1---------------------------------111---- 131-3121111111----------------------1-33--1212-1---11-11-2--1-22-114441-11131211111-111-3231-5------1----12413--------------112111111112---121112-1111111---------111--2221-----------------23-112222222332222222343332222123-5216776644512222222222222221122232-22-12-14422433231112342223333311444444443443333333333333222111322221-162222222222121113341112-31-------1-1-1165511111111----------------------------------------111--2--21--2221-------1------1------------------------------------------------1--------------------------------------------------------1-----------------------------------11--------1------------------------------123---------1111---111----------1----------122-11-1111111111-1111121111111111111333-----2222222222222223-1111112--211111111111------------------111-----------------------------------------211111111-33323333333233------------------11111111-111-1-----------1---------1------12211-3221--2 --------------------------------------------------------------------------------------------------------------3111121111-11132111381-1141-11111111-11-111111111-----------------------------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 99.7 SQ:SECSTR cEcEEEEEEcccEEEEEEEcTTccEEEEEEEEccccccHHHHHHHHHHHHTTTGGGccEEEEEEEEccEEETTEEEcccGcGGGGGGTTccHHHHHHHHHcccEEEEEHHHHHHHHHHHTccTTcccEEEEEEcccEEEEEEETTEEEEccTTcccccGGGccccTTccccTTcccccHHHHHcHHHGGGTTccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHTcTTHHHHHHHHHHTTccGGHHHGccEEEEccccccHHHHHHHHHHHHHH# DISOP:02AL 294-295| PSIPRED ccEEEEEEEcccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccEEccccEEEEccccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEccEEEcccccccccEEEEEEccccHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHcccHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHcc //