[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55557.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:HMM:PFM   17->32 PF00014 * Kunitz_BPTI 0.0002 31.2 16/53  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55557.1 GT:GENE ACF55557.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1352122..1352277 GB:FROM 1352122 GB:TO 1352277 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55557.1 GB:DB_XREF GI:194357109 LENGTH 51 SQ:AASEQ MSIFLDFFQILFVKILTLWYYNNMKMKCKGFNLDDYLILQLIFYKRKELVA GT:EXON 1|1-51:0| TM:NTM 2 TM:REGION 1->22| TM:REGION 31->51| HM:PFM:NREP 1 HM:PFM:REP 17->32|PF00014|0.0002|31.2|16/53|Kunitz_BPTI| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHcc //