[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55569.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  165->266 1n9wA1  b.40.4.1 * 6e-04 14.6 %
:RPS:PFM   1->178 PF09323 * DUF1980 2e-48 56.2 %
:RPS:PFM   182->228 PF02554 * CstA 8e-04 44.7 %
:HMM:PFM   1->178 PF09323 * DUF1980 9.3e-68 46.1 178/182  
:BLT:SWISS 1->271 YCGQ_BACSU 1e-50 40.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55569.1 GT:GENE ACF55569.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(807513..808328) GB:FROM 807513 GB:TO 808328 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55569.1 GB:DB_XREF GI:194357121 LENGTH 271 SQ:AASEQ MIRFLVLAGYFELTIYLHLSGKLNQYINMHYSYLAYISMVISFILAIVQLYIWMKQVKTHSHLNSRLAKMTSISLLAIPLVIGLTFPTVSLDSQTVSAKGYHFPLSEGTDLAIQTSEGTTSQYLKPDTSSYFSKSAYEKEMRTAADKYLSQDSIQVTNENYMEVMEAIYDYPDEFEGKTIQFTGFVYNDPSHANSQFLFRFGIIHCIADSGVYGLLTKGNTRQYENNTWITAKGKLVNHYHKELKQNLPTLEIDSFTKVDKPENPYVYRAF GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 1->271|YCGQ_BACSU|1e-50|40.0|265/100| TM:NTM 3 TM:REGION 1->23| TM:REGION 32->54| TM:REGION 67->88| RP:PFM:NREP 2 RP:PFM:REP 1->178|PF09323|2e-48|56.2|176/182|DUF1980| RP:PFM:REP 182->228|PF02554|8e-04|44.7|47/379|CstA| HM:PFM:NREP 1 HM:PFM:REP 1->178|PF09323|9.3e-68|46.1|178/182|DUF1980| GO:PFM:NREP 2 GO:PFM GO:0009267|"GO:cellular response to starvation"|PF02554|IPR003706| GO:PFM GO:0016020|"GO:membrane"|PF02554|IPR003706| RP:SCP:NREP 1 RP:SCP:REP 165->266|1n9wA1|6e-04|14.6|89/93|b.40.4.1| OP:NHOMO 97 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222222211212221-122-122111-----1111111---------------------1-------------------------11112111111111111111111111111111111111111111---12-------------------1----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 58-66,104-122,144-152| PSIPRED cHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHEEEEEEEEcEEEcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccccccEEEEEcccccHHHccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHccHHHHcccEEEEEEEEEccccccccEEEEEEEEEEEEEEccEEEEEEEccccccccccEEEEEEEEEEEEEccccccccEEEEEEEEEccccccccccccc //