[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55570.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y2045_STRPI  RecName: Full=UPF0374 protein SPH_2045;

Homologs  Archaea  0/68 : Bacteria  136/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->177 3cbtA PDBj 3e-22 10.9 %
:RPS:PFM   61->123 PF04167 * DUF402 3e-11 50.8 %
:HMM:PFM   59->124 PF04167 * DUF402 9e-22 37.9 66/72  
:BLT:SWISS 1->177 Y2045_STRPI e-104 97.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55570.1 GT:GENE ACF55570.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1734364..1734897 GB:FROM 1734364 GB:TO 1734897 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF04167 GB:PROTEIN_ID ACF55570.1 GB:DB_XREF GI:194357122 LENGTH 177 SQ:AASEQ MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHKKYWFNIIAMIRDNGTSYYCNMASPYYXDEXALKYIDYDLDVKIFTDGEKRXLDVEEYERHKRKMNYSDDLDYILKEHVKILVXWINNGRGPFSEAYVNIWYKRYVELKNR GT:EXON 1|1-177:0| SW:ID Y2045_STRPI SW:DE RecName: Full=UPF0374 protein SPH_2045; SW:GN OrderedLocusNames=SPH_2045; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->177|Y2045_STRPI|e-104|97.7|177/177| RP:PDB:NREP 1 RP:PDB:REP 2->177|3cbtA|3e-22|10.9|165/209| RP:PFM:NREP 1 RP:PFM:REP 61->123|PF04167|3e-11|50.8|63/71|DUF402| HM:PFM:NREP 1 HM:PFM:REP 59->124|PF04167|9e-22|37.9|66/72|DUF402| OP:NHOMO 136 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111-1-11--1-111--1111111111111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11-11-----1-1-11111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 93.2 SQ:SECSTR #EEEEEETTEEEEEEcTTcEEEEEEETTcccGGGccHHHHTTccEEEEEEEcccc#####cEEEEEcTTccEEEEEEEETTEEEEEEEEcccEEETTEEEEcEEEEEEEEcTTccEEEEcHHHHHHHH#HTTccHHHHHHHHHHHHHHHHHHHHTcTTG#####GGTGGGccccTTc DISOP:02AL 1-2,176-178| PSIPRED ccccccccEEEEEEEEEccEEEEEccccEEEEEcccEEEEEEccEEEEccccccccccccEEEEEcccccEEEEEEEccccEEEEEEccccccccccEEEEEEEccEEEEcccccEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHc //