[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55583.1
DDBJ      :             ATP synthase F1, beta subunit
Swiss-Prot:ATPB_STRZP   RecName: Full=ATP synthase subunit beta;         EC=3.6.3.14;AltName: Full=F-ATPase subunit beta;AltName: Full=ATP synthase F1 sector subunit beta;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.69.1b.49.1c.37.1
:468 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->467 1skyE PDBj 0.0 76.4 %
:RPS:PDB   2->467 2ck3F PDBj e-129 62.6 %
:RPS:SCOP  2->79 1bmfD2  b.49.1.1 * 7e-19 56.2 %
:RPS:SCOP  80->349 1bmfD3  c.37.1.11 * 4e-77 65.1 %
:RPS:SCOP  351->466 1bmfD1  a.69.1.1 * 2e-29 61.2 %
:HMM:SCOP  1->79 1skyE2 b.49.1.1 * 2.9e-25 61.5 %
:HMM:SCOP  80->355 1e79A3 c.37.1.11 * 3e-96 44.5 %
:HMM:SCOP  351->468 1e79D1 a.69.1.1 * 7.2e-47 63.6 %
:RPS:PFM   8->77 PF02874 * ATP-synt_ab_N 4e-15 65.7 %
:RPS:PFM   134->348 PF00006 * ATP-synt_ab 8e-33 37.9 %
:RPS:PFM   363->458 PF00306 * ATP-synt_ab_C 1e-22 54.2 %
:HMM:PFM   134->348 PF00006 * ATP-synt_ab 1.5e-69 36.0 211/215  
:HMM:PFM   362->463 PF00306 * ATP-synt_ab_C 2.1e-28 35.4 99/113  
:HMM:PFM   6->77 PF02874 * ATP-synt_ab_N 5e-25 63.8 69/69  
:BLT:SWISS 1->468 ATPB_STRZP 0.0 99.8 %
:PROS 339->348|PS00152|ATPASE_ALPHA_BETA
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55583.1 GT:GENE ACF55583.1 GT:PRODUCT ATP synthase F1, beta subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1382201..1383607) GB:FROM 1382201 GB:TO 1383607 GB:DIRECTION - GB:PRODUCT ATP synthase F1, beta subunit GB:NOTE Martin-Galiano, A.J. (2001) Mol.Micr. 41(6), 1327-1338; identified by match to protein family HMM PF00006; match to protein family HMM PF00306; match to protein family HMM PF02874; match to protein family HMM TIGR01039 GB:PROTEIN_ID ACF55583.1 GB:DB_XREF GI:194357135 GB:GENE:NOTE atp beta LENGTH 468 SQ:AASEQ MSSGKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNXNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDVIAKAEKMGF GT:EXON 1|1-468:0| SW:ID ATPB_STRZP SW:DE RecName: Full=ATP synthase subunit beta; EC=3.6.3.14;AltName: Full=F-ATPase subunit beta;AltName: Full=ATP synthase F1 sector subunit beta; SW:GN Name=atpD; OrderedLocusNames=SPP_1527; SW:KW ATP synthesis; ATP-binding; Cell membrane; CF(1); Complete proteome;Hydrogen ion transport; Hydrolase; Ion transport; Membrane;Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->468|ATPB_STRZP|0.0|99.8|468/468| GO:SWS:NREP 10 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 339->348|PS00152|ATPASE_ALPHA_BETA|PDOC00137| SEG 147->163|kggkvglfggagvgktv| SEG 306->320|paddytdpapatafa| BL:PDB:NREP 1 BL:PDB:REP 1->467|1skyE|0.0|76.4|466/470| RP:PDB:NREP 1 RP:PDB:REP 2->467|2ck3F|e-129|62.6|460/466| RP:PFM:NREP 3 RP:PFM:REP 8->77|PF02874|4e-15|65.7|67/68|ATP-synt_ab_N| RP:PFM:REP 134->348|PF00006|8e-33|37.9|211/212|ATP-synt_ab| RP:PFM:REP 363->458|PF00306|1e-22|54.2|96/106|ATP-synt_ab_C| HM:PFM:NREP 3 HM:PFM:REP 134->348|PF00006|1.5e-69|36.0|211/215|ATP-synt_ab| HM:PFM:REP 362->463|PF00306|2.1e-28|35.4|99/113|ATP-synt_ab_C| HM:PFM:REP 6->77|PF02874|5e-25|63.8|69/69|ATP-synt_ab_N| GO:PFM:NREP 9 GO:PFM GO:0015992|"GO:proton transport"|PF02874|IPR004100| GO:PFM GO:0016469|"GO:proton-transporting two-sector ATPase complex"|PF02874|IPR004100| GO:PFM GO:0046034|"GO:ATP metabolic process"|PF02874|IPR004100| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0005524|"GO:ATP binding"|PF00006|IPR000194| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00306|IPR000793| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF00306|IPR000793| GO:PFM GO:0033178|"GO:proton-transporting two-sector ATPase complex, catalytic domain"|PF00306|IPR000793| RP:SCP:NREP 3 RP:SCP:REP 2->79|1bmfD2|7e-19|56.2|73/73|b.49.1.1| RP:SCP:REP 80->349|1bmfD3|4e-77|65.1|269/276|c.37.1.11| RP:SCP:REP 351->466|1bmfD1|2e-29|61.2|116/118|a.69.1.1| HM:SCP:REP 1->79|1skyE2|2.9e-25|61.5|78/82|b.49.1.1|1/2|N-terminal domain of alpha and beta subunits of F1 ATP synthase| HM:SCP:REP 80->355|1e79A3|3e-96|44.5|274/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 351->468|1e79D1|7.2e-47|63.6|118/118|a.69.1.1|1/1|C-terminal domain of alpha and beta subunits of F1 ATP synthase| OP:NHOMO 3672 OP:NHOMOORG 1171 OP:PATTERN 22222222222222222212222222222222222222222222222622442122222222221222 3333221111111222222-22222222222222221111222121122223121221221131212112111111112222233733443423112222222222223244444444444444443222224224222222222344223322222222222422222222222222222222222244233333333333333333333333333333333335555543422222222222222222222422222222222222222222222222222222422422444242424444444444444422222222233333555555555535335444755343553333333353333333544335333321111435342222322333333333333-4444434444234333445333332232353363653332222222223342343111222222222222122222222222222222233444354446547575446588893834843332233433433342543334433353222222234523333523353335444433333357755553262333323333333333333333353222352333235353534354433342344443222533333133343244353553333233-543344333353523322322244544555555555555555532334334635666665665652242222223555428352222222222222222222222222534434333353333345422222222233336333337653333444444452222223433333311111111346----2-34332423235322643333233353353421 3333334-F6513344334344344453332233333444434233233443423441444444434424434444434444444434-464333222344438B8124354855541123153633614L4-3533112422353321132143844534334435945844336444W343239ABD3954463333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 467 STR:RPRED 99.8 SQ:SECSTR ccEEEEEEEETTEEEEEEccccccccTTcEEEETTccccccccEEEEEEEEETTEEEEEEccccTTccTTcEEEEcccccEEEEcGGGTTcEEcTTccccccccccccccEEEEcccccccGGGccccccEEccccHHHHHHccEETTcEEEEEEcTTccHHHHHHHHHHHTTTTcccEEEEEEEcccHHHHHHHHHHHHHHTccccEEEEEEcTTccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTHHHHHHHHHHHHHHTccccGGGccTTHHHHHHHHHTTccccTTccEEEEEEEEcGGGcTTcHHHHHHGGGccEEEEccHHHHHTTccccccTTccEETTccHHHHcHHHHHHHHHHHHHHHHHHTTHHHHHHHcGGGccHHHHHHHHHHHHHHHHTccccGGGHHHHccccccccHHHHHHHHHHHHTTTTTTccGGGGTTcccHHHHHHHHHHHc# DISOP:02AL 1-1,267-271| PSIPRED ccEEEEEEEEccEEEEEEcccccccccccEEEEEEcccccccEEEEEEEEccccEEEEEEcccccccccccEEEEcccccEEEccccccccEEcccccccccccccccccEEccccccccccccccccccHHHccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccEEEEEEEEcccccccccHHHHHHHHccEEEEcHHHHHccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHccc //