[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55602.1
DDBJ      :             Type I restriction modification DNA specificity domain
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.287.1
:191 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   61->146 1admA PDBj 1e-06 15.1 %
:RPS:SCOP  2->151 1yf2A1  d.287.1.2 * 2e-17 18.7 %
:HMM:SCOP  2->173 1yf2A1 d.287.1.2 * 3.2e-26 28.5 %
:RPS:PFM   4->151 PF01420 * Methylase_S 9e-13 35.9 %
:HMM:PFM   2->165 PF01420 * Methylase_S 9.8e-22 24.5 159/167  
:BLT:SWISS 3->151 T1SB_ECOLX 4e-16 29.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55602.1 GT:GENE ACF55602.1 GT:PRODUCT Type I restriction modification DNA specificity domain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 789679..790254 GB:FROM 789679 GB:TO 790254 GB:DIRECTION + GB:PRODUCT Type I restriction modification DNA specificity domain GB:NOTE identified by match to protein family HMM PF01420 GB:PROTEIN_ID ACF55602.1 GB:DB_XREF GI:194357154 LENGTH 191 SQ:AASEQ MKKVKLGQVATFINGYAFKPQDWSSEGKEIIRIQNLTKTSKGINYYSGTIDKKYIVEAGDILISWSGTLGVFQWCGRSAVLNQHIFKVVFDKIDIDKSYFKYVVEKGLQDAVKHTHGSTMKHLTKKYFDNIMVSYTNLGEQQRIASELDLLSKLILRRQEQLEELNLLVKSQFACEIAIKVWRNSLKFSII GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 3->151|T1SB_ECOLX|4e-16|29.1|148/474| SEG 154->168|lilrrqeqleelnll| RP:PDB:NREP 1 RP:PDB:REP 61->146|1admA|1e-06|15.1|86/415| RP:PFM:NREP 1 RP:PFM:REP 4->151|PF01420|9e-13|35.9|142/167|Methylase_S| HM:PFM:NREP 1 HM:PFM:REP 2->165|PF01420|9.8e-22|24.5|159/167|Methylase_S| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF01420|IPR000055| GO:PFM GO:0006304|"GO:DNA modification"|PF01420|IPR000055| RP:SCP:NREP 1 RP:SCP:REP 2->151|1yf2A1|2e-17|18.7|150/220|d.287.1.2| HM:SCP:REP 2->173|1yf2A1|3.2e-26|28.5|172/0|d.287.1.2|1/1|DNA methylase specificity domain| OP:NHOMO 43 OP:NHOMOORG 38 OP:PATTERN ----1--------------------------------------1------1-1--------------- -1-------------------------------------------------------------------------------------------------------------------------------1-------------------1--------------------------------------------------------------------------------------------------------------------11--------1---------------1221121------------------------------------------------------1---------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1--------1------------------1-------1---------------------------------------------22--1---------1--------------------1-------------1----------------------1------1------------------1-------------------------------------------------------------------1-----------------1-----------------1-----------------------1--------------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 50.3 SQ:SECSTR ##################################################TcGGGGccEEEEcccccccccEEEEcccccccccEEEEEcTTcEEcHHHHHHHHTcHHHHHHHHHHTTccccccHHHHTTcEETTEEccccccccc############################################# PSIPRED cEEEEEccEEEEEEcccccccccccccEEEEEEcccccccccccccccccccccEEccccEEEEEEcccEEEEEEcccEEEEccEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcc //