[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55606.1
DDBJ      :             cell division protein FtsL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->102 PF04977 * DivIC 3.2e-07 20.8 72/80  
:BLT:SWISS 44->104 CP110_MOUSE 5e-04 32.8 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55606.1 GT:GENE ACF55606.1 GT:PRODUCT cell division protein FtsL GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 292317..292634 GB:FROM 292317 GB:TO 292634 GB:DIRECTION + GB:PRODUCT cell division protein FtsL GB:NOTE identified by match to protein family HMM TIGR02209 GB:PROTEIN_ID ACF55606.1 GB:DB_XREF GI:194357158 LENGTH 105 SQ:AASEQ MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQTKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIAE GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 44->104|CP110_MOUSE|5e-04|32.8|61/2334| COIL:NAA 45 COIL:NSEG 1 COIL:REGION 44->88| TM:NTM 1 TM:REGION 26->48| HM:PFM:NREP 1 HM:PFM:REP 31->102|PF04977|3.2e-07|20.8|72/80|DivIC| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,65-66,68-69,100-100,103-106| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccccc //