[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55615.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:259 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 66->188 PTA_HAEIN 7e-04 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55615.1 GT:GENE ACF55615.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 492330..493109 GB:FROM 492330 GB:TO 493109 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55615.1 GB:DB_XREF GI:194357167 LENGTH 259 SQ:AASEQ MAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFSKELGPQDIPTLLEQGPTSLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITIPADVAQFYTFSLKLAQELGYIYGYEDLWASREELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAKQVMKTVPNKALTKTLWYPILKKVLKIFGVNLTKGGLAKGIGKFIPILGGIISGGLTFATMKPMGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 66->188|PTA_HAEIN|7e-04|29.4|119/100| SEG 9->22|qvlqqvvklpvvkv| SEG 204->215|ipilggiisggl| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------1------1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111111-1111--------------11---111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,257-260| PSIPRED ccHHHHHHHHHHHHHHcccEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcc //