[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55628.1
DDBJ      :             NADH oxidase
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  187/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->185 2bc1A PDBj 5e-69 71.4 %
:RPS:PDB   1->123 1dxlA PDBj 7e-10 15.7 %
:RPS:SCOP  3->179 1fcdA1  c.3.1.5 * 3e-07 18.4 %
:HMM:SCOP  1->187 1gv4A1 c.3.1.5 * 2.7e-17 26.5 %
:RPS:PFM   62->128 PF00743 * FMO-like 4e-04 40.6 %
:HMM:PFM   3->178 PF07992 * Pyr_redox_2 1.6e-26 25.7 152/202  
:BLT:SWISS 1->185 NAOX_STRP6 3e-70 72.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55628.1 GT:GENE ACF55628.1 GT:PRODUCT NADH oxidase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1351405..1351980) GB:FROM 1351405 GB:TO 1351980 GB:DIRECTION - GB:PRODUCT NADH oxidase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF07992 GB:PROTEIN_ID ACF55628.1 GB:DB_XREF GI:194357180 LENGTH 191 SQ:AASEQ MSKIVVVGANHAGTACINTMLDNFGNENEIVVFDQNSNISFLGCGMALWIGEQIDGAEGLFYSDKEKLEAKGAKVYMNSPVLSIDYDNKVVTAEVEGKEHKESYEKLIFATGSTPILPPIEGVEIVKGNREFKATLENVQFVKLYQNAEXVINKLXDESQHFDRXAVVGGXXIGXEIXGXXESXGXRRGPX GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|NAOX_STRP6|3e-70|72.1|183/456| SEG 169->189|ggxxigxeixgxxesxgxrrg| BL:PDB:NREP 1 BL:PDB:REP 2->185|2bc1A|5e-69|71.4|182/473| RP:PDB:NREP 1 RP:PDB:REP 1->123|1dxlA|7e-10|15.7|121/467| RP:PFM:NREP 1 RP:PFM:REP 62->128|PF00743|4e-04|40.6|64/247|FMO-like| HM:PFM:NREP 1 HM:PFM:REP 3->178|PF07992|1.6e-26|25.7|152/202|Pyr_redox_2| GO:PFM:NREP 4 GO:PFM GO:0004499|"GO:flavin-containing monooxygenase activity"|PF00743|IPR000960| GO:PFM GO:0050660|"GO:FAD binding"|PF00743|IPR000960| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00743|IPR000960| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00743|IPR000960| RP:SCP:NREP 1 RP:SCP:REP 3->179|1fcdA1|3e-07|18.4|158/186|c.3.1.5| HM:SCP:REP 1->187|1gv4A1|2.7e-17|26.5|170/0|c.3.1.5|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 279 OP:NHOMOORG 206 OP:PATTERN ----------------11-1-11-----1--111--1-11111----------1-------------- -----1------------------------------1------------------------------11---1111111---------1111--11------------------------------------------------------------------------------------------11----2-11111-1-1-11---2-----11--1-22232------11--------------111-1313-33-11--55113431423-322111211111111111111111111111111111112211122231---2222222231222--111131--1---1---121-2-----11--2--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---1-----1-------1------------------------------------112----------11--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1--11---------1-211-----------------2--------------11111112-2-21111111111111---1--11-------- -----------1----------------------------------------1--------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 96.9 SQ:SECSTR ccEEEEEccccccccHHHHccHHHHHHHHHHHHHHHHHHHTHHHHTcccccccccHHHHHHHHHHHHHHHHHTcEEEEccEEEEETTEEEEcEccccccEEEEccEEEEcccEEEcccTTcccHHHcEEHHHHTTcccTTEEEcccHHHHccccHHTTcTTcccEEEEcccHHHHHHHHHHHHTT###### DISOP:02AL 184-184,187-192| PSIPRED ccEEEEEcccHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHccccccHHHEEEccHHHHHHcccEEEEccEEEEEEccccEEEEEEcccEEEEEccEEEEcccccccccccccccccccccHHHHHHcccHHHccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccccc //