[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55636.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->229 PF09922 * DUF2154 8e-11 32.2 %
:HMM:PFM   5->229 PF09922 * DUF2154 5.3e-67 36.8 223/233  
:BLT:SWISS 43->229 LIAF_BACSU 3e-08 24.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55636.1 GT:GENE ACF55636.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 345146..345844 GB:FROM 345146 GB:TO 345844 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55636.1 GB:DB_XREF GI:194357188 LENGTH 232 SQ:AASEQ MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTTMIGDVEVVRG GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 43->229|LIAF_BACSU|3e-08|24.5|184/100| TM:NTM 2 TM:REGION 13->35| TM:REGION 59->81| SEG 30->41|fllilflfllli| SEG 102->111|eevvtvkkek| RP:PFM:NREP 1 RP:PFM:REP 6->229|PF09922|8e-11|32.2|205/220|DUF2154| HM:PFM:NREP 1 HM:PFM:REP 5->229|PF09922|5.3e-67|36.8|223/233|DUF2154| OP:NHOMO 74 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----11-1--111111--111111111111111-----1----------------1--------11111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEcccccEEEEEcccEEccccEEcccccEEEEEEEEEEEEccccEEcccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcccHHHcccEEEEEEEccccccccEEEEEEEEEEEEEEEEEEc //