[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55642.1
DDBJ      :             protease
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  554/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:428 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->173 1a50A PDBj 2e-08 14.8 %
:RPS:SCOP  12->173 1a50A  c.1.2.4 * 1e-08 14.8 %
:RPS:PFM   85->309 PF01136 * Peptidase_U32 4e-57 48.0 %
:HMM:PFM   84->312 PF01136 * Peptidase_U32 2e-84 46.9 226/233  
:BLT:SWISS 6->407 YRRO_BACSU e-115 49.2 %
:PROS 165->183|PS01276|PEPTIDASE_U32
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55642.1 GT:GENE ACF55642.1 GT:PRODUCT protease GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1330097..1331383) GB:FROM 1330097 GB:TO 1331383 GB:DIRECTION - GB:PRODUCT protease GB:NOTE identified by match to protein family HMM PF01136 GB:PROTEIN_ID ACF55642.1 GB:DB_XREF GI:194357194 LENGTH 428 SQ:AASEQ MTKTLKRPEVLSPAGTLEKLKVAVQYGADAVFIGGQAYGLRSRAGNFTFEQMEEGVQFAAKYGAKVYVAXNMVMHEGNEAGAGEWFRKLRDIGIAAVIVSDPALIMIAATEAPGLEIHLSTQASATNYETLEFWKELGLTRVVLAREVSMEELAEIRKRTDVEIEAFVHGAMCISYSGRCTLSNHMSMRDANRGGCSQSCRWKYDLYDMPFGKERKSLQGEIPEEFSMSAVDMSMIDHIPDMIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYLESSEKFEAIKQDLVDEMWKVAQRELVTGFYYGTPSENEQLFGARCKIPEYKFVAEVVSYDDAXQTATIRQRNVINEGDQVEFYGPGFRHFETYIEDLHDAKGNKIDRAPNPMELLTIKVPQPVQSGDMVRALKEGLINFYKEDGTSVTVRA GT:EXON 1|1-428:0| BL:SWS:NREP 1 BL:SWS:REP 6->407|YRRO_BACSU|e-115|49.2|400/422| PROS 165->183|PS01276|PEPTIDASE_U32|PDOC00982| SEG 59->70|aakygakvyvax| RP:PDB:NREP 1 RP:PDB:REP 12->173|1a50A|2e-08|14.8|162/260| RP:PFM:NREP 1 RP:PFM:REP 85->309|PF01136|4e-57|48.0|221/231|Peptidase_U32| HM:PFM:NREP 1 HM:PFM:REP 84->312|PF01136|2e-84|46.9|226/233|Peptidase_U32| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF01136|IPR001539| GO:PFM GO:0008233|"GO:peptidase activity"|PF01136|IPR001539| RP:SCP:NREP 1 RP:SCP:REP 12->173|1a50A|1e-08|14.8|162/260|c.1.2.4| OP:NHOMO 1056 OP:NHOMOORG 586 OP:PATTERN --------------------------------332111111111111113333--------------- --1--------------------------------------------------------------------11111111222-1111122221222--1-121---1------------------11111111111111-----1----1---111111111-1--11111------------111------32222222222222222-222222222221--222222211222222222222222222222----------------------222222222222233333333332222221222222222222222222223222222222222222222222222-222122222321212222-221-11--1-------1----11111111111111111---------1----11---1---11----1--11111-----------1----111----------------------------------1----1------11111---1111111---1121112212-23321-3-11-2212133111111111-33322324222112222-222222222----11-311111111111111111111111111132312132-123333334433333345354--1-111------33223313333333332-3333333323333333333333221123333333333333333222322231-222222222222---2---------1-2-11111111111-1111111111---12-22222222222223111111111111123332222233322--------------112211------------2-1-----------1------1--------1--------12 ------------------------------------------------------------------------------------------------------------2------------------------------------------------------1-------------117111-1--------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 37.9 SQ:SECSTR ###########cHHHHHHHHHHHHHTTcccEEEEcHHHHHHHHHTTccHHHHHHHHHHHHHHcccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHTTcEEEcEEcTTccHHHHHHHEEcccccccccccHHHHHHHHTTcccEEEcccccHH############################################################################################################################################################################################################################################################### DISOP:02AL 1-3,317-323,423-429| PSIPRED ccccccccEEEEccccHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEEccccHHHccHHHHHHHcccccccccccccccccccEEcccccccccccccccccccEEEcHHHHHHHHHHHHHHHccccEEEEccEEccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccHHccccccccccccEEEEEEEEEEccccEEEEEEccccccccEEEEEcccccEEEEEEccEEcccccEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHcccccccccccc //