[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55647.1
DDBJ      :             PTS system,  IID component
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  215/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:303 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->303 PF03613 * EIID-AGA 4e-75 53.6 %
:HMM:PFM   6->303 PF03613 * EIID-AGA 2.3e-120 58.0 262/264  
:BLT:SWISS 10->212 PTND_ECOLI 5e-65 53.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55647.1 GT:GENE ACF55647.1 GT:PRODUCT PTS system, IID component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(257556..258467) GB:FROM 257556 GB:TO 258467 GB:DIRECTION - GB:PRODUCT PTS system, IID component GB:NOTE identified by match to protein family HMM PF03613; match to protein family HMM TIGR00828 GB:PROTEIN_ID ACF55647.1 GB:DB_XREF GI:194357199 LENGTH 303 SQ:AASEQ MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIKKLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGMMGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGYKAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHWDKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKVSPITIILALFAVGIVAHVLHIM GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 10->212|PTND_ECOLI|5e-65|53.7|203/286| TM:NTM 5 TM:REGION 105->127| TM:REGION 139->161| TM:REGION 184->206| TM:REGION 256->277| TM:REGION 281->303| SEG 124->133|lgslgaslal| SEG 257->277|ldmlipglsgllltllcmyll| RP:PFM:NREP 1 RP:PFM:REP 5->303|PF03613|4e-75|53.6|263/263|EIID-AGA| HM:PFM:NREP 1 HM:PFM:REP 6->303|PF03613|2.3e-120|58.0|262/264|EIID-AGA| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03613|IPR004704| GO:PFM GO:0016021|"GO:integral to membrane"|PF03613|IPR004704| OP:NHOMO 573 OP:NHOMOORG 216 OP:PATTERN ----------------1--------------------------------------------------- ------------------------------------------------------------------------------3---------------------------------------------------------------------------------------------------------------1----------1-------1-11-1-------1--444444----------------------D1116E1131522--6714522211132344443334443343444433333333333333331113333---29111-1--312-5---542---1-3--------------111-212----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-1----------------------------2---------------------1----1--1------------311133-2544254543-4323444443454332334433122213432333443324223322244221-222222212222111---------------2222121----2111----------------------------------------112--------12-----------------1---------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,86-91| PSIPRED ccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccc //