[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55649.1
DDBJ      :             type I restriction-modification system, M subunit
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  458/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:487 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->421 2okcA PDBj 1e-36 32.5 %
:RPS:PDB   79->485 2ar0A PDBj 1e-24 21.3 %
:RPS:SCOP  62->485 2ar0A1  c.66.1.45 * 6e-21 22.3 %
:HMM:SCOP  1->485 2ar0A1 c.66.1.45 * 7.4e-104 32.6 %
:RPS:PFM   149->424 PF02384 * N6_Mtase 3e-36 41.9 %
:HMM:PFM   143->442 PF02384 * N6_Mtase 5.6e-70 33.6 286/311  
:HMM:PFM   4->133 PF12161 * HsdM_N 4e-14 24.1 112/132  
:BLT:SWISS 1->480 T1ME_ECOLX e-132 50.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55649.1 GT:GENE ACF55649.1 GT:PRODUCT type I restriction-modification system, M subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(455426..456889) GB:FROM 455426 GB:TO 456889 GB:DIRECTION - GB:PRODUCT type I restriction-modification system, M subunit GB:NOTE identified by match to protein family HMM PF02384; match to protein family HMM PF05175 GB:PROTEIN_ID ACF55649.1 GB:DB_XREF GI:194357201 LENGTH 487 SQ:AASEQ MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMVWELEEDEYESIIPKELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNMPIRKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGNSGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNTAVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGGSELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKLVDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPMKSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEEEILNPFELIQNYQAERATLNHKIDNVLADILQLLEDK GT:EXON 1|1-487:0| BL:SWS:NREP 1 BL:SWS:REP 1->480|T1ME_ECOLX|e-132|50.8|474/490| BL:PDB:NREP 1 BL:PDB:REP 5->421|2okcA|1e-36|32.5|375/413| RP:PDB:NREP 1 RP:PDB:REP 79->485|2ar0A|1e-24|21.3|399/476| RP:PFM:NREP 1 RP:PFM:REP 149->424|PF02384|3e-36|41.9|258/273|N6_Mtase| HM:PFM:NREP 2 HM:PFM:REP 143->442|PF02384|5.6e-70|33.6|286/311|N6_Mtase| HM:PFM:REP 4->133|PF12161|4e-14|24.1|112/132|HsdM_N| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF02384|IPR003356| GO:PFM GO:0006306|"GO:DNA methylation"|PF02384|IPR003356| GO:PFM GO:0008170|"GO:N-methyltransferase activity"|PF02384|IPR003356| RP:SCP:NREP 1 RP:SCP:REP 62->485|2ar0A1|6e-21|22.3|421/485|c.66.1.45| HM:SCP:REP 1->485|2ar0A1|7.4e-104|32.6|451/0|c.66.1.45|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 751 OP:NHOMOORG 479 OP:PATTERN ----1--------1-------------------1132--2--112-1-12228-1-----11-----1 11---111---1-2-1-11-12--1-11111-12-22----221-1-11-----------1-1-------------1111-2---1---322---------1-21-1-1----------------123142--3---11-21--3-2-4-114----------121-2421-------------2-------11-----11----1-----22-----121----1-1--111-22222222222222--111---111--12--122-2-1-1--111-1---1-11-222222222221111111111111-341212221-3---111-21-11-1---1-1-----3-131--12--22211--111--215---2-----111---2--1-1-1111111111------------1------111---1-2-11----11-12111111111---1------------------12113----------------2---1-----------------1--11----1--1-411-13--1-2-6--4-211--2211-1131-2-11-29---4-1311--2115--422-1-1-21--112-22121-12223231221-1-33-1323-------32-521-5-11-3--5-1--142-1-------1-33-2111111112--1---222-11111111111-1-1221-11111-2122--1-1-111-1-1-------2----111------------11111122111--31223131----11-13112--1--1--11-1-211-31-1-21-111221---4-31115-1-21212222111--11--1111--------2-1-1-3--2--221-1112-113-1111-2-1------21 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 483 STR:RPRED 99.2 SQ:SECSTR ####cHHHHHHHHHHHHHHTTcHHHHEEEccTGGGGccccccccEEETTEEEcHHHHHHHHHHcccccEEEcTTTccTTcHHHHHHHHHHHHHHHTcHHHHccTTccHHHHHTccHHHHHHHHHHHHHHTccccHHHHHHHTTcccccccHHHHHHHHHHHTccccccccHHHHHHHHHHHcccTTccEEETTcTTTHHHHHHHHHHHTTTTTTTTHHHHHTcEEEEEccHHHHHHHHHHHTTTccccGGGTccEEEccTTcHHHTcccEEEEEEccccTTcccccccccccccccccccHHHHHHHHHHHEEEEEEEEEEEEHHHHHccTHHHHHHHHHHHHEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEccTccTTccccccccccGGGTHHHHHHHcccTTcccccccccTTcTTcEEcccGGGTcEEEEEHHHHHHTcccccccccEEcccccHHHHHHHHHHHHHHHHHH DISOP:02AL 1-1,486-488| PSIPRED ccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHccccEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHcccccccccccEEEEEEEccHHHHHHHHHHHHHcccccccEEEccccccccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEccHHHHccccHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEEcccccccEEEEEEEcccHHHcccccccccHHHHHHHHHHHHHcccccccccccEEEccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //