[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55650.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  262/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->101 1uwdA PDBj 2e-14 33.3 %
:RPS:PDB   13->109 3cq1A PDBj 3e-22 35.8 %
:RPS:SCOP  13->110 1uwdA  d.52.8.2 * 4e-22 31.6 %
:HMM:SCOP  9->110 1uwdA_ d.52.8.2 * 2.1e-22 32.4 %
:RPS:PFM   15->89 PF01883 * DUF59 1e-10 34.7 %
:HMM:PFM   15->89 PF01883 * DUF59 3.8e-17 28.0 75/76  
:BLT:SWISS 13->110 YITW_BACSU 9e-20 38.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55650.1 GT:GENE ACF55650.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1950168..1950509 GB:FROM 1950168 GB:TO 1950509 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01883 GB:PROTEIN_ID ACF55650.1 GB:DB_XREF GI:194357202 LENGTH 113 SQ:AASEQ MRDDIKINDRALALQDQIIEKLEKVFDTDVELDVYNLGLIYEINLDETGLCKIVMTFTDTACDCAESLPIEIVAGLKQIEGIKDIKVEVTWSPAWKITRISRYGRIALGLPPR GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 13->110|YITW_BACSU|9e-20|38.8|98/102| BL:PDB:NREP 1 BL:PDB:REP 15->101|1uwdA|2e-14|33.3|87/102| RP:PDB:NREP 1 RP:PDB:REP 13->109|3cq1A|3e-22|35.8|95/98| RP:PFM:NREP 1 RP:PFM:REP 15->89|PF01883|1e-10|34.7|75/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 15->89|PF01883|3.8e-17|28.0|75/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 13->110|1uwdA|4e-22|31.6|98/102|d.52.8.2| HM:SCP:REP 9->110|1uwdA_|2.1e-22|32.4|102/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 320 OP:NHOMOORG 277 OP:PATTERN ----1------------1---11---------------------------11--1111111-----11 -11-------------------------------------1----------------------1------11111111------1--1111111--1--11111111111-----------------------------------1--------------------1----------------11111-----1---------------111111---12211--111111--1111111111111111111112--11-213233221111-12-11111111112222222222222211111111111112222222221----------------------------2------------------------1111111111--22111--1--11111111112-1111111111111111111111111211111111111111111111111111-11-----------------------------111111-------------------------------1-------------1--------1----------------------------------------1--1----111--------------------21----------------------------------11-----------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------1111------------------------------------1111111111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 85.8 SQ:SECSTR ############HHHHHHHHHHTTcccTTTcccTTTTTcEEEEEEETTEEEEEEEcccccccccccHHHHHHHHHHHTcTTccEEEEEEcccccccGGGcccGGGTTTc#### DISOP:02AL 1-8| PSIPRED cccccccccHHHHHHHHHHHHHHHcccccccccEEEcccEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHccHHHHHHcccccc //