[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55654.1
DDBJ      :             phosphotransferase LicD2
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  62/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:269 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  9->166 2ewrA1  d.218.1.11 * 3e-15 16.1 %
:RPS:PFM   25->136 PF04991 * LicD 2e-25 52.0 %
:RPS:PFM   196->245 PF04991 * LicD 4e-05 40.0 %
:HMM:PFM   24->245 PF04991 * LicD 8.5e-50 33.0 185/191  
:BLT:SWISS 1->266 LICD_HAEIN 1e-28 32.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55654.1 GT:GENE ACF55654.1 GT:PRODUCT phosphotransferase LicD2 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1141752..1142561 GB:FROM 1141752 GB:TO 1142561 GB:DIRECTION + GB:PRODUCT phosphotransferase LicD2 GB:NOTE identified by match to protein family HMM PF04991 GB:PROTEIN_ID ACF55654.1 GB:DB_XREF GI:194357206 LENGTH 269 SQ:AASEQ MQYLEKKEIKEIQLALLDYIDETCKKHDIPYFLSYGTMLGAIRHKGMIPWDDDIDISLYREDYERLLKIIEEENHHRYKVLSYDTSSWYFHNFASILDTSTVIEDHVKYKRHDTSLFIDVFPIDRFTDLSIVDKSYKYVALRQLAYIKKSRAVHGDSKLKDFLRLCSWYALRFVNPRYXYKKIDQXVKNAVTNTPQYEGGVGIGKEGMKEIFPVDTFKELILTXFEGRMLPVPKKYDQFLTQMYGDYMTPPSKEMQEWYSHSIKAYRKN GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 1->266|LICD_HAEIN|1e-28|32.7|257/265| RP:PFM:NREP 2 RP:PFM:REP 25->136|PF04991|2e-25|52.0|100/145|LicD| RP:PFM:REP 196->245|PF04991|4e-05|40.0|46/145|LicD| HM:PFM:NREP 1 HM:PFM:REP 24->245|PF04991|8.5e-50|33.0|185/191|LicD| RP:SCP:NREP 1 RP:SCP:REP 9->166|2ewrA1|3e-15|16.1|143/156|d.218.1.11| OP:NHOMO 124 OP:NHOMOORG 65 OP:PATTERN --------------------------------31---------------------------------- -----------------------------------------------------------------------------12244------21-2-4---------------------------------------------------------------------------------------------------------------------------------------------------------------2-11--1----11------11--1--111----1--33334333433-------------1-------------1-------1-1------11------52-----------------1---------------------------------------------------------------------------------------------------------1-11-21112111-----------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-2-22--------------------------------------------------1------------------------------------------------2--------------------------2 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------8------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHccccccccccEEEEEEHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEcccEEEcHHcccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHccccHHHHHHHHHHHHcccccccEEEEEEcccccccccccHHHccccEEEEEccEEEEccccHHHHHHHHcccccccccHHHccccccEEEEEEcc //