[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55655.1
DDBJ      :             sucrose-6-phosphate hydrolase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  237/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
b.29.1b.67.2
:484 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->478 1uypA PDBj 7e-39 31.9 %
:RPS:PDB   31->456 2ac1A PDBj 3e-76 24.3 %
:RPS:SCOP  32->340 1uypA2  b.67.2.3 * 3e-39 30.6 %
:RPS:SCOP  352->479 1y4wA1  b.29.1.19 * 2e-22 25.0 %
:HMM:SCOP  26->341 1y4wA2 b.67.2.3 * 4e-83 39.7 %
:HMM:SCOP  341->478 1uypA1 b.29.1.19 * 3.6e-29 39.4 %
:RPS:PFM   37->338 PF00251 * Glyco_hydro_32N 3e-42 40.9 %
:HMM:PFM   37->340 PF00251 * Glyco_hydro_32N 2e-83 40.1 287/308  
:HMM:PFM   377->446 PF08244 * Glyco_hydro_32C 2.2e-14 25.7 70/86  
:BLT:SWISS 8->479 SCRB_STRMU 0.0 64.0 %
:PROS 37->50|PS00609|GLYCOSYL_HYDROL_F32

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55655.1 GT:GENE ACF55655.1 GT:PRODUCT sucrose-6-phosphate hydrolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1575773..1577227 GB:FROM 1575773 GB:TO 1577227 GB:DIRECTION + GB:PRODUCT sucrose-6-phosphate hydrolase GB:NOTE identified by match to protein family HMM PF00251; match to protein family HMM PF08244; match to protein family HMM TIGR01322 GB:PROTEIN_ID ACF55655.1 GB:DB_XREF GI:194357207 LENGTH 484 SQ:AASEQ MEWTTERRYRLYQDWTQEEIQHIKENMAQSPWHTHYHVEPKTGLLNDPNGFSYFDGKWILFYQNFPFGAAHGLKSWAQLESDDLVHFRETGVKVLPDTPLDSHGAYSGSAMQFGDNLFLFYTGNVRDENWIRHPYQIGALMDKEGKITKIDKILIDQPADSTDHFRDPQIFNFKGQYYAVVGGQDLEKKGFVRLYKAVNNDYTNWQAVGDLDFANDRTAYMMECPNLVFVXEQPVLLYCPQGLDKKVLDYDNIFPNMYKIGASFDPKNAKMVDVSQLQNMDYGFEAYATQAFNAPDGRALAVSWLGLPDVSYPSDRFDHQGTFSLVKELTIKDDKLYQYPVAAIKDLRASEEAFSNRSQTKNTYELELNLEANSQSEIVLLADKEGKGLSINFDLVNGQVTVDRSQAGEQYAQEFGTTRSCPIENQATTATIFIDNSVFEIFINKGEKVFSGRVFPHADQNGILIKSGNPTGIYYELDYGRKTN GT:EXON 1|1-484:0| BL:SWS:NREP 1 BL:SWS:REP 8->479|SCRB_STRMU|0.0|64.0|472/479| PROS 37->50|PS00609|GLYCOSYL_HYDROL_F32|PDOC00532| BL:PDB:NREP 1 BL:PDB:REP 35->478|1uypA|7e-39|31.9|405/432| RP:PDB:NREP 1 RP:PDB:REP 31->456|2ac1A|3e-76|24.3|415/537| RP:PFM:NREP 1 RP:PFM:REP 37->338|PF00251|3e-42|40.9|286/301|Glyco_hydro_32N| HM:PFM:NREP 2 HM:PFM:REP 37->340|PF00251|2e-83|40.1|287/308|Glyco_hydro_32N| HM:PFM:REP 377->446|PF08244|2.2e-14|25.7|70/86|Glyco_hydro_32C| RP:SCP:NREP 2 RP:SCP:REP 32->340|1uypA2|3e-39|30.6|288/294|b.67.2.3| RP:SCP:REP 352->479|1y4wA1|2e-22|25.0|128/164|b.29.1.19| HM:SCP:REP 26->341|1y4wA2|4e-83|39.7|312/0|b.67.2.3|1/1|Arabinanase/levansucrase/invertase| HM:SCP:REP 341->478|1uypA1|3.6e-29|39.4|127/138|b.29.1.19|1/1|Concanavalin A-like lectins/glucanases| OP:NHOMO 381 OP:NHOMOORG 270 OP:PATTERN ------------------------1--1--1------------------------------------- 111--1--111-1--------------------------------1------234-----------1----11111111---------1131-1------1--1---1----------------------------111-------------------------------------------------11--22111111---11-1--31441311--1---12-------21111111111111111111122--11-12-111--1111111----11111113222222222222211111111111112221112223---24-------1-1-1---112---1---1------------11----3------------1--------------------------1----------11-211121----------------------------------------------------------------1--1---------------------------1---------11-------------------------------------------------------------------------------------------111-----1-1--------------------------------1111-13-11---2-2--1--122-1111-1------222111-1----------------2--11111--1-----------------------------111111-----1--1----------1------1--------1111111-1111-----11111----------------------1---------------------2-----------1-1-----------1-111--- --------63---------1---------------------------1--1-1311---1111-----2------11-11----------------------1-1--2----------------------------------------------------------3---1-------------13968-82------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 478 STR:RPRED 98.8 SQ:SECSTR EEccHHHHHTHHHHTTcGGGccccccGGccTTccccccccccEEEEEEEEEEEETTEEEEEEEEcTTcccccccEEEEEEEccccccEEEEEEEccccGGGTTcEEEEEEEEcTTcEEEEEEEEcTTccEEEEEccTTcTTcccEEEcTTcccccccTTTcTTcEEcccccEEcccEEEEEEEEEETTEEEEEEEEEcEccccccEEcccccEEEETccccEEEEEEEETTccEEEccccccccEEEEEETTTTEEEEEEETEEETTTTEEEccTTcccccccccEEEEEEEETTTTEEEEEEEEcccccHHHHHHHTEEcEEcccEEEEEcTTcEEEEEcGGGGGGcccccEEEEEEEEcTTEEEEcccccTTEEEEEEEEcTTccccEEEEEEEEccTTccccccTTcccccEEEEEccccTTccEEEEEEEETTEEEEEETTTTEEEEEEccccGGGTcccEETTEEEcTTTEEc###### DISOP:02AL 1-2,482-485| PSIPRED ccccccccEEEHHHccHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEccEEEEEEcccccccccccEEEEEEEEccccccEEcccEEccccccccccEEEEEEEEEccEEEEEEEccccccccEEEEEEEEEEEccccEEEccccccccccccccccccccEEEEEccEEEEEEEEEEcccccEEEEEEEcccccEEEEEcccccccccccEEEEEcccEEEEccccEEEEEcccccccccccccccccEEEEEEEEcccccEEccccccEEEEccccEEEEEEEEcccccEEEEEEEcccccccccccccccccccccEEEEEEccEEEEEEHHHHHHHHccccEEEEEEEcccEEEEEEEEEccccccEEEEEcccccEEEEEEEEEccEEEEEccccccccccccccEEEEEEccccEEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEEEEEcccEEEEEEEEEccccc //