[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55663.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->71 1adrA PDBj 4e-08 25.0 %
:RPS:SCOP  15->66 2auwA1  a.35.1.10 * 1e-08 7.7 %
:HMM:SCOP  1->73 1dw9A1 a.35.1.4 * 6.1e-13 21.9 %
:HMM:PFM   5->59 PF01381 * HTH_3 6.5e-16 32.7 55/55  
:BLT:SWISS 15->67 YOBD_BACSU 2e-07 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55663.1 GT:GENE ACF55663.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 946747..946968 GB:FROM 946747 GB:TO 946968 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF01381 GB:PROTEIN_ID ACF55663.1 GB:DB_XREF GI:194357215 LENGTH 73 SQ:AASEQ MYRRLRDLREDHDLTQKQIAKILSFTDSAYAKIERGEHTLTADILVTLSNFYDVSTDYLLGLTDFPDKIRFRK GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 15->67|YOBD_BACSU|2e-07|43.4|53/112| SEG 3->14|rrlrdlredhdl| RP:PDB:NREP 1 RP:PDB:REP 16->71|1adrA|4e-08|25.0|56/76| HM:PFM:NREP 1 HM:PFM:REP 5->59|PF01381|6.5e-16|32.7|55/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 15->66|2auwA1|1e-08|7.7|52/67|a.35.1.10| HM:SCP:REP 1->73|1dw9A1|6.1e-13|21.9|73/0|a.35.1.4|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 20 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------11-1--1-111----11-111---11---2-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 80.8 SQ:SECSTR ##############cHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHTTccHHHHHHTcccccTTTcHH DISOP:02AL 1-1,67-74| PSIPRED cHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccccHHHHcc //