[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55676.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->76 PF11195 * DUF2829 3e-14 50.7 %
:HMM:PFM   1->76 PF11195 * DUF2829 1.5e-28 50.7 75/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55676.1 GT:GENE ACF55676.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 701321..701557 GB:FROM 701321 GB:TO 701557 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACF55676.1 GB:DB_XREF GI:194357228 LENGTH 78 SQ:AASEQ MTFEEILPGLKAKRKYVRTGWGGAENYVQLFDTIEQNGLALEMTPYFLINVSGEGEGFSMWSPTVCDVLATDWVEVHD GT:EXON 1|1-78:0| RP:PFM:NREP 1 RP:PFM:REP 1->76|PF11195|3e-14|50.7|75/75|DUF2829| HM:PFM:NREP 1 HM:PFM:REP 1->76|PF11195|1.5e-28|50.7|75/75|DUF2829| OP:NHOMO 53 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1---11-----11--11111---11111111111--111111111111111111111111111---1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHcccEEEEEccccccEEEEEEcccccccEEEccccEEEEEEccccccccccccccccccccccEEEcc //