[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55677.1
DDBJ      :             PTS system, IIC component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:267 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->238 PF03609 * EII-Sor 3e-23 35.5 %
:HMM:PFM   1->239 PF03609 * EII-Sor 5.7e-85 49.4 235/237  
:BLT:SWISS 21->243 PTNC_SHIFL 1e-31 34.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55677.1 GT:GENE ACF55677.1 GT:PRODUCT PTS system, IIC component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(258491..259294) GB:FROM 258491 GB:TO 259294 GB:DIRECTION - GB:PRODUCT PTS system, IIC component GB:NOTE identified by match to protein family HMM PF03609 GB:PROTEIN_ID ACF55677.1 GB:DB_XREF GI:194357229 LENGTH 267 SQ:AASEQ MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLEAGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPLAVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMVPTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSDITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 21->243|PTNC_SHIFL|1e-31|34.2|219/266| TM:NTM 7 TM:REGION 2->24| TM:REGION 34->56| TM:REGION 66->88| TM:REGION 100->122| TM:REGION 146->168| TM:REGION 182->204| TM:REGION 215->237| SEG 1->20|msiismvlvvvvaffagleg| SEG 64->82|igaaiapdaalasvaaaii| SEG 126->137|adaaakkgdfga| SEG 182->199|gmaigggmvvavgyamvi| SEG 246->252|ggngggg| RP:PFM:NREP 1 RP:PFM:REP 21->238|PF03609|3e-23|35.5|214/235|EII-Sor| HM:PFM:NREP 1 HM:PFM:REP 1->239|PF03609|5.7e-85|49.4|235/237|EII-Sor| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03609|IPR004700| GO:PFM GO:0016021|"GO:integral to membrane"|PF03609|IPR004700| OP:NHOMO 269 OP:NHOMOORG 189 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------11-1-------1--333333----------------------5111131121211--221331111111111111111111111111111111111111111111111111----16----1--212-2---111---1-1------------------112---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--1------------111111-1222122211-21112221212221111122211111-2122222222222222122122221-211111111111111---------------2222121----1111------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 243-258| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcc //