[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55685.1
DDBJ      :             methyltransferase GidB
Swiss-Prot:RSMG_STRZT   RecName: Full=Ribosomal RNA small subunit methyltransferase G;         EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase;         Short=16S rRNA m7G methyltransferase;

Homologs  Archaea  0/68 : Bacteria  634/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->237 1xdzA PDBj 5e-55 55.3 %
:RPS:PDB   15->159 3c3pC PDBj 4e-09 12.9 %
:RPS:SCOP  9->219 1jsxA  c.66.1.20 * 1e-43 30.1 %
:HMM:SCOP  1->238 1xdzA_ c.66.1.20 * 9.3e-50 33.3 %
:RPS:PFM   21->162 PF02527 * GidB 9e-36 53.7 %
:HMM:PFM   21->192 PF02527 * GidB 1.4e-51 42.8 166/184  
:BLT:SWISS 1->237 RSMG_STRZT e-117 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55685.1 GT:GENE ACF55685.1 GT:PRODUCT methyltransferase GidB GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1154287..1155000 GB:FROM 1154287 GB:TO 1155000 GB:DIRECTION + GB:PRODUCT methyltransferase GidB GB:NOTE identified by match to protein family HMM PF02527; match to protein family HMM TIGR00138 GB:PROTEIN_ID ACF55685.1 GB:DB_XREF GI:194357237 LENGTH 237 SQ:AASEQ MKPKTFYNLLAEQNLPLSDQQKEQFERYFELLVEWNEKINLTAITDKEEVYLKHFYDSIAPILQGLIPNETIKLLDIGAGAGFPSLPMKILYPELDVTIIDSLNKRINFLQLLAQELDLNGVHFYHGRAEDFAQDKNFRAQYDFVTARAVARMQVLSELTIPYLKVGGKLLALKASNAPEELLEAKNALNLLFSKVEDNLSYALPNRDPRYITVVEKKKETPNKYPRKAGMPNKRPL GT:EXON 1|1-237:0| SW:ID RSMG_STRZT SW:DE RecName: Full=Ribosomal RNA small subunit methyltransferase G; EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase; Short=16S rRNA m7G methyltransferase; SW:GN Name=rsmG; OrderedLocusNames=SPT_0942; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->237|RSMG_STRZT|e-117|100.0|237/237| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 164->175|lkvggkllalka| SEG 177->192|napeelleaknalnll| BL:PDB:NREP 1 BL:PDB:REP 1->237|1xdzA|5e-55|55.3|235/238| RP:PDB:NREP 1 RP:PDB:REP 15->159|3c3pC|4e-09|12.9|139/190| RP:PFM:NREP 1 RP:PFM:REP 21->162|PF02527|9e-36|53.7|136/183|GidB| HM:PFM:NREP 1 HM:PFM:REP 21->192|PF02527|1.4e-51|42.8|166/184|GidB| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF02527|IPR003682| GO:PFM GO:0006364|"GO:rRNA processing"|PF02527|IPR003682| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF02527|IPR003682| RP:SCP:NREP 1 RP:SCP:REP 9->219|1jsxA|1e-43|30.1|183/193|c.66.1.20| HM:SCP:REP 1->238|1xdzA_|9.3e-50|33.3|237/0|c.66.1.20|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 654 OP:NHOMOORG 649 OP:PATTERN -------------------------------------------------------------------- 111--1111111111----------1-------------------11--11-1111-------1---1111----111--11-1-111111111111--11111111111-------------------1--1-11111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111121-11-11----11--1-1--------------------------------1-----------------1--1-----1-------------1-111----------11-------------------11--111111111111------11-----1111111111111111111111111111111111111111111--111121---------111111111111-1-1121----------11111111111111111111-1111111111111111111111111--11111------111111111111111-1-1111111111111111-11111111111111111111111111111111111-111111111111--1-111111111111-111111111111111111111111111111111111111111111---------111111111111111--1-1--111----1-1-----------------1111-1-111111-1111111111111111111111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1111-111--2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 99.6 SQ:SECSTR ccHHHcccTTHHTTcccccHHHHHHHHHHHHTcccccHHHHHHHHHHTTTcccccHHHHHHHHHHHHHHcccEEEEEccGGGHHHHHHHHHccTTcEEEEEccHHHHHHHHHHHHHcGGGGEEEEEccHHHHHTTcccTTcEEEEEETTTccHHHHHHHHGGGEEEEEEEEEEEcccHHHHHHHHHHHHHTT#EEEEEEEEEEcTTccEEEEEEEEEcccccTTccccTTHHHHccc DISOP:02AL 1-1,237-238| PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEcEEEEccHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccccEEEEccHHHccccccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHcccEEEEEEEEEccccccEEEEEEEEcccccccccccccccccccc //