[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55689.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->173 PF07155 * DUF1393 2.5e-09 17.7 164/169  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55689.1 GT:GENE ACF55689.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1101948..1102475 GB:FROM 1101948 GB:TO 1102475 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55689.1 GB:DB_XREF GI:194357241 LENGTH 175 SQ:AASEQ MNTRKKTQFMTMTALLTAIAILIPIVMPFKIVIPPASYTLGSHIAIFIAMFLSPLMAVFVILASSFGFLMAGYPMVIVFRAFSHISFGALGALYLQKFPDTLDKPKSSWVFNFVLAVVHALAEVLACVLFYATSGTNVENMFYVLFVLVGFGTIIHSMVDYTLALAVYKVLRKRR GT:EXON 1|1-175:0| TM:NTM 5 TM:REGION 12->34| TM:REGION 45->67| TM:REGION 75->97| TM:REGION 110->132| TM:REGION 144->166| SEG 10->23|mtmtalltaiaili| SEG 114->129|vlavvhalaevlacvl| HM:PFM:NREP 1 HM:PFM:REP 6->173|PF07155|2.5e-09|17.7|164/169|DUF1393| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------111---111111111111111111-------------11-1111111--1-11111111111----1---1-------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //