[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55690.1
DDBJ      :             regulatory protein, GntR
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  209/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->120 3by6E PDBj 8e-16 29.2 %
:RPS:PDB   2->120 3by6D PDBj 1e-20 27.7 %
:RPS:SCOP  6->94 1v4rA1  a.4.5.6 * 4e-17 27.0 %
:HMM:SCOP  2->103 1v4rA1 a.4.5.6 * 2.3e-16 31.0 %
:RPS:PFM   14->74 PF00392 * GntR 4e-06 44.3 %
:HMM:PFM   12->74 PF00392 * GntR 2.4e-18 42.9 63/64  
:HMM:PFM   59->100 PF10011 * DUF2254 0.00068 28.6 42/371  
:BLT:SWISS 5->120 YHCF_BACSU 5e-22 40.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55690.1 GT:GENE ACF55690.1 GT:PRODUCT regulatory protein, GntR GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1566216..1566581 GB:FROM 1566216 GB:TO 1566581 GB:DIRECTION + GB:PRODUCT regulatory protein, GntR GB:NOTE identified by match to protein family HMM PF00392 GB:PROTEIN_ID ACF55690.1 GB:DB_XREF GI:194357242 LENGTH 121 SQ:AASEQ MSWTFDNKKPIYLQIMEKIKLQIVSHTLEPNQQLPTVRELASEAGVNPNTIQRALSDLEREGFVYSKRTTGRFVTKDKELIAQSRKQLSEEELEHFVSSMTHFGYEKEELPGVVSDYIKGV GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 5->120|YHCF_BACSU|5e-22|40.5|116/121| BL:PDB:NREP 1 BL:PDB:REP 8->120|3by6E|8e-16|29.2|113/124| RP:PDB:NREP 1 RP:PDB:REP 2->120|3by6D|1e-20|27.7|119/121| RP:PFM:NREP 1 RP:PFM:REP 14->74|PF00392|4e-06|44.3|61/64|GntR| HM:PFM:NREP 2 HM:PFM:REP 12->74|PF00392|2.4e-18|42.9|63/64|GntR| HM:PFM:REP 59->100|PF10011|0.00068|28.6|42/371|DUF2254| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 6->94|1v4rA1|4e-17|27.0|89/100|a.4.5.6| HM:SCP:REP 2->103|1v4rA1|2.3e-16|31.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 372 OP:NHOMOORG 210 OP:PATTERN ---------------------------------------------1---------------------- 1-1--------1-1-----------------------1---1---1---------------------1-1----------421-----111--111---------1---1----------------------------------1-------------------------------------------11-1233333323322233334433332222212221333323-311111111111111111211-112112-11233--111-1111---1111111-11111111111111111111111111-11111111133-1466655553525533222263-31-43--33121312-21121---1-2----------------------------------------------------------------------------------------------------------------------------------11111-----11---------------------------------------------------------------------------------------------------------------------------1-----------1------------------------------------------------------------------------------------------1--------------1----------------------------------------1-----------------------------------------11------------------------------1---------------------------11111-11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 99.2 SQ:SECSTR HcccccccccHHHHHHHHHHHHHHTTcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTc# DISOP:02AL 1-6,79-91| PSIPRED ccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //