[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55694.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55694.1 GT:GENE ACF55694.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1881082..1881636 GB:FROM 1881082 GB:TO 1881636 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55694.1 GB:DB_XREF GI:194357246 LENGTH 184 SQ:AASEQ MPKLLETEKYSLDSIIDGGKLRMISKFCPDLHGLRYEFKTSDSITKEYCKKIRQALRDSDPEGKSGKKCMMRYTIDILNVWNTLCRTRDFITGSLKADDVIDGKTGIYFFDVNTSNVITDDVIENVKINHKSLVRNVDEXNIESISKEIPKGTDMYYYVLYRLGLNRIKYNYLVKALAGAIQKD GT:EXON 1|1-184:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,7-7,183-185| PSIPRED ccccHHHHHccHHHHHccHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //